BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060661.seq (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 7.1 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.1 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.1 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +2 Query: 284 VVLLYWTRTRHAACWHAPSTFGNKP 358 ++LLY+ ++H + W + + +KP Sbjct: 10 LLLLYYIYSKHYSYWQSKNVPTDKP 34 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 317 AACWHAPSTFGNKPPDLLSQK*IRKRPISLSRSPN 421 AA WH PS + P PIS S P+ Sbjct: 185 AASWHTPSMYPLSPGAGFRSPYPSALPISTSSLPS 219 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 317 AACWHAPSTFGNKPPDLLSQK*IRKRPISLSRSPN 421 AA WH PS + P PIS S P+ Sbjct: 77 AASWHTPSMYPLSPGAGFRSPYPSALPISTSSLPS 111 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 570 MCLLHRHLWALTTR 529 +C LH HL L TR Sbjct: 578 ICTLHHHLSKLVTR 591 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 570 MCLLHRHLWALTTR 529 +C LH HL L TR Sbjct: 222 ICTLHHHLSKLVTR 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,027 Number of Sequences: 336 Number of extensions: 3709 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -