BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060658.seq (497 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 75 6e-15 SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 75 6e-15 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 71 1e-13 SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosacch... 27 1.6 SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A... 27 1.6 SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosacchar... 27 1.6 SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B sub... 27 1.6 SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2... 27 1.6 SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S... 25 4.8 SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 8.4 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 8.4 SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 25 8.4 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 74.9 bits (176), Expect = 6e-15 Identities = 34/64 (53%), Positives = 49/64 (76%) Frame = +3 Query: 63 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 242 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 243 NIGS 254 NIGS Sbjct: 61 NIGS 64 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 74.9 bits (176), Expect = 6e-15 Identities = 34/64 (53%), Positives = 49/64 (76%) Frame = +3 Query: 63 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 242 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 243 NIGS 254 NIGS Sbjct: 61 NIGS 64 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 70.5 bits (165), Expect = 1e-13 Identities = 31/64 (48%), Positives = 48/64 (75%) Frame = +3 Query: 63 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 242 +S +ELA Y+ALIL D+ + +T +K+ ++ KA V+VEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLKELLL 60 Query: 243 NIGS 254 NIGS Sbjct: 61 NIGS 64 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosaccharomyces pombe|chr 3|||Manual Length = 312 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 302 SDEDMGFGLFD 312 >SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosaccharomyces pombe|chr 1|||Manual Length = 186 Score = 27.1 bits (57), Expect = 1.6 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Frame = +3 Query: 45 RSKLKMVSKAELACVYSALILVD-DDV--AVTGEKISTILKAAAVDVEPYWPGLFAKALE 215 R+ L+ + E S L+L + DV A++ E+IS IL + +W AL Sbjct: 103 RNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYK-SSHWRIFSVSALT 161 Query: 216 GINVRDLITNIGSE 257 G+N++D I+ + ++ Sbjct: 162 GLNIKDAISWLAND 175 >SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2C subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 362 SDDDMGFGLFD 394 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|Schizosaccharomyces pombe|chr 3|||Manual Length = 624 Score = 25.4 bits (53), Expect = 4.8 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 219 INVRDLITNIGSEWVL 266 +N RD++TN SEW++ Sbjct: 208 LNERDILTNTNSEWLV 223 >SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 27 GLRQLARSKLKMVSKAELACVYSAL 101 G+ QL + ++SKA+L C Y L Sbjct: 159 GMLQLDMPHVNILSKADLLCTYGTL 183 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 234 GHGH*CLPRLWRTDL 190 G+G CLP LWR D+ Sbjct: 402 GNGVQCLPLLWRQDI 416 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 24.6 bits (51), Expect = 8.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -3 Query: 237 SGHGH*CLPRLWRTDLANMALHLQPPLSRWWKFSHQ 130 SGHG P L + + M L+ PL + W++ + Sbjct: 357 SGHGFKFFPILGKYSIGCMFRELEEPLLKKWRWKKE 392 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,547,902 Number of Sequences: 5004 Number of extensions: 25561 Number of successful extensions: 87 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -