Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060658.seq
         (497 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    22   4.1  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    21   9.4  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    21   9.4  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 5/34 (14%)
 Frame = -3

Query: 459 LIT*KLYNRQNGIF-----LFLHKAS*SKRPKPM 373
           +++ +LY+RQNG+      L L K   + +P PM
Sbjct: 278 MVSPRLYDRQNGLVLSRMNLTLAKMEKTSKPLPM 311


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +2

Query: 149 HLESGGCRCR 178
           +L SGGC C+
Sbjct: 241 YLPSGGCHCK 250


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -3

Query: 411 LHKAS*SKRPKP 376
           LH+AS SK P+P
Sbjct: 554 LHRASLSKTPQP 565


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,772
Number of Sequences: 438
Number of extensions: 1775
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 13618701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)