BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060657.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.4 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 5.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 5.4 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 73 SDLNLKSKDQPEHENNDIKNSRVTPPPQFQDKQKTPYESHTKTDKNLTHDSKREKLKF 246 S + S ++ NN+ K+S+ + PPQ K + + + N ++KR++ + Sbjct: 172 STSSTSSTEKAGTNNNNSKSSQSSNPPQIYPWMKRVHLGQSTVNAN--GETKRQRTSY 227 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 161 KTNRKPHTNPIQKPTK 208 K KP T+ QKPTK Sbjct: 1156 KPGHKPSTSSWQKPTK 1171 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 280 NCTSAKFKSLLGTLIFHVSNRVLSF 206 N T+A+F L I VSN V++F Sbjct: 305 NFTAARFFELNRRTILGVSNAVITF 329 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = +3 Query: 246 PRRDLNFADVQLDLACMSTPKMLAPDEFM 332 P+RD+ + + L+ +S P M P + + Sbjct: 9 PKRDMLDSQEKTPLSSVSYPSMFTPSQLL 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,942 Number of Sequences: 336 Number of extensions: 3148 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -