BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060657.seq (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 26 0.96 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 26 0.96 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 26 0.96 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 26 0.96 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 25 1.7 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 26.2 bits (55), Expect = 0.96 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 7 EVGYPEVEMLIPHYNERLVATDSDLNLKSKDQPEHENNDIKNSRVTPP 150 EV PE+++ + + ++ ++ D + + P HE D K+S TPP Sbjct: 116 EVAQPELKLNLLNESD-FTFSERDSVMLGEISPHHEYFDSKSSSETPP 162 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 26.2 bits (55), Expect = 0.96 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 7 EVGYPEVEMLIPHYNERLVATDSDLNLKSKDQPEHENNDIKNSRVTPP 150 EV PE+++ + + ++ ++ D + + P HE D K+S TPP Sbjct: 116 EVAQPELKLNLLNESD-FTFSERDSVMLGEISPHHEYFDSKSSSETPP 162 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 26.2 bits (55), Expect = 0.96 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 7 EVGYPEVEMLIPHYNERLVATDSDLNLKSKDQPEHENNDIKNSRVTPP 150 EV PE+++ + + ++ ++ D + + P HE D K+S TPP Sbjct: 116 EVAQPELKLNLLNESD-FTFSERDSVMLGEISPHHEYFDSKSSSETPP 162 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 26.2 bits (55), Expect = 0.96 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 7 EVGYPEVEMLIPHYNERLVATDSDLNLKSKDQPEHENNDIKNSRVTPP 150 EV PE+++ + + ++ ++ D + + P HE D K+S TPP Sbjct: 116 EVAQPELKLNLLNESD-FTFSERDSVMLGEISPHHEYFDSKSSSETPP 162 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 384 DFNRSRVVXNNQNEILYRERS 446 D NR+R V + +N +LYR+R+ Sbjct: 165 DRNRNRYVSDVENPLLYRDRT 185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,301 Number of Sequences: 2352 Number of extensions: 12571 Number of successful extensions: 31 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -