BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060656.seq (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) 29 4.7 SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) 28 6.2 >SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 564 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 560 EAEHTDARDRRICHSRRRENHFAVNRPLTRMGLTKKTKKN 679 + ++ RD CH+ + H+ PLT G T++ KN Sbjct: 177 QGDYLQLRDPT-CHAYENKTHYIFKTPLTGCGTTRRHTKN 215 >SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) Length = 942 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = +2 Query: 14 HRPPWWPTSRPKMINLNRLLHRRPCSRSLRNSRWSPSRQRMRPYP 148 H P W P P H ++ R ++W+ R+ +RP P Sbjct: 429 HDPQWLPDDHPAYQEYTEATHSMGGAKGYRFNKWT-QRENIRPTP 472 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,068,451 Number of Sequences: 59808 Number of extensions: 431614 Number of successful extensions: 1485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -