BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060656.seq (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 25 0.68 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 25 0.68 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 25 0.68 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.3 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.68 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 516 SQAAAHDKGLPKAMVKPNILTHVIEGYVIPGGGRTISR*T 635 S+ +++ P++ KP+++ I GGG T SR T Sbjct: 256 SETNHNERSTPRSHAKPSLIDDEPTEVTIGGGGTTSSRRT 295 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.68 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 516 SQAAAHDKGLPKAMVKPNILTHVIEGYVIPGGGRTISR*T 635 S+ +++ P++ KP+++ I GGG T SR T Sbjct: 256 SETNHNERSTPRSHAKPSLIDDEPTEVTIGGGGTTSSRRT 295 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.68 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 516 SQAAAHDKGLPKAMVKPNILTHVIEGYVIPGGGRTISR*T 635 S+ +++ P++ KP+++ I GGG T SR T Sbjct: 256 SETNHNERSTPRSHAKPSLIDDEPTEVTIGGGGTTSSRRT 295 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.2 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 468 RYINYVQEHAMYSAHISQAAAHDKGLPKAMVKPNILTHVIEGYV 599 R +N++ H Y +S+ +K L NI+TH+I YV Sbjct: 759 RSVNHLLTHHEYDYELSRGYIDEKILENQ----NIITHMILNYV 798 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 8.3 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 365 PQKWSCLTHLEIPRRELSQPPKRSPSSTK-SVRVWWRRGP 249 P K + H ++ S PP+++P S K S R RR P Sbjct: 376 PSKNPAMGHWQMSCVACSPPPRQTPPSRKESGRRRRRRTP 415 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,371 Number of Sequences: 438 Number of extensions: 4043 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -