BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060654.seq (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.33 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 9.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 0.33 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = -3 Query: 658 IMEYRSSTFPPIREQTIDPPAS*YLFQRLKQPISWSKETSFITSW 524 + E R P + T+ PP Q L P S K + T+W Sbjct: 1788 VEEEREEAPPSVHSSTVVPPPQHSTTQSLVDPKSEFKVVCYFTNW 1832 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.0 bits (42), Expect = 9.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 544 SLLTKILVVSVFETNIRMLGGLLSAHVLAETLKSDI 651 +++ K+L +S + + + L +VLAE SDI Sbjct: 483 TIIPKVLAMSRDQNYLYRMTCLFCINVLAEACGSDI 518 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,400 Number of Sequences: 336 Number of extensions: 3794 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -