BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060654.seq (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 1.7 AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor... 25 2.2 AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor... 25 2.2 AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor... 23 6.8 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 9.0 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 9.0 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 9.0 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 9.0 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 9.0 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 9.0 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 9.0 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 9.0 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 9.0 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 9.0 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 9.0 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 9.0 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 9.0 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 9.0 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 9.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.0 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 653 GISLFNVSANT*ADNRPPSILI 588 G+SLF ++ DN+PP++LI Sbjct: 470 GVSLFASHHHSTGDNKPPNLLI 491 >AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 557 LVKRDIFYNELDCMIKSEKSPITTKVSKLSTNVNEKF 447 +VK DIF LD + K P+T K K ++V EK+ Sbjct: 126 MVKADIFIIHLDELEKMLNDPLTMK--KNQSSVREKW 160 >AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 25.0 bits (52), Expect = 2.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 557 LVKRDIFYNELDCMIKSEKSPITTKVSKLSTNVNEKF 447 +VK DIF LD + K P+T K K ++V EK+ Sbjct: 129 MVKADIFIIHLDELEKMLNDPLTMK--KNQSSVREKW 163 >AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.8 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 557 LVKRDIFYNELDCMIKSEKSPITTKVSKLSTNVNEKF 447 +VK DIF L + K P+T K K ++V EK+ Sbjct: 128 MVKADIFITHLGELEKMLNDPLTMK--KNQSSVREKW 162 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 38 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 69 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 38 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 69 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 40 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 71 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 40 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 71 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 43 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 74 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 43 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 74 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 53 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 84 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 55 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 86 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 55 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 86 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 37 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 68 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 37 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 68 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 43 QHFYFQ*NVNVLETDVSIL*KLFSSTFYLFVN 138 +HFY N N + D+S+ +L +T Y N Sbjct: 52 EHFYGAHNFNYHDQDISLYHRLSITTKYYETN 83 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 397 CPCN*EASVHQLDMHSPCKHDKHDR 323 CPCN + D CK +K+DR Sbjct: 1005 CPCNDNVEGRRCDR---CKENKYDR 1026 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,834 Number of Sequences: 2352 Number of extensions: 15267 Number of successful extensions: 117 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -