BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060651.seq (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 5.2 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 9.0 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 74 LECVSQNGRSFRSAIYKLITKRS 6 L CVS G++FR AI+ + KRS Sbjct: 428 LYCVS--GQNFRKAIFGMFQKRS 448 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -3 Query: 313 TSTTAVLAAPPRGHGAVRPCPGPHSLTSGRAGQWASFS 200 T+T +L PP + + P P + SG A +S S Sbjct: 860 TATGGMLKMPPSSNSSPSSYPSPDVVISGLASNNSSSS 897 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,836 Number of Sequences: 2352 Number of extensions: 10172 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -