BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060650.seq (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663... 30 2.0 03_06_0116 + 31773295-31773603,31773800-31773946,31774080-317741... 29 4.6 >12_02_0871 + 23865343-23866016,23866122-23866170,23866276-23866356, 23866599-23866718,23866957-23867055,23867135-23867194, 23867316-23867410,23867483-23867508,23869212-23869285, 23870194-23870259,23871027-23871099,23871585-23871622, 23873758-23873871,23876079-23876195,23876288-23876368, 23876468-23876536,23876631-23876669,23876809-23876973, 23877380-23877484,23877569-23877637,23877754-23877816, 23877903-23878021,23878124-23878348,23878409-23878610 Length = 940 Score = 29.9 bits (64), Expect = 2.0 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 23 CL*IINKRIQFEK-GI-KMQGPAVFMDISLEDQALELRRYFKSLGAEISEEKSPKGIED 193 C I++ RI ++ GI K+QG + +D+SL+ L K G E EE K +ED Sbjct: 431 CGEIVDLRIMKDQNGISKLQGKRLAVDLSLDQDTLFFGNLCKDWGIEEFEELIRKALED 489 >03_06_0116 + 31773295-31773603,31773800-31773946,31774080-31774158, 31777558-31778180 Length = 385 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 328 AFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYHVY 447 AFS+R K PK + L W L+ + P +R H+Y Sbjct: 227 AFSKRTKKGKLPKEARLKLLHWWELHYDKWPYPSVRTHIY 266 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,694,972 Number of Sequences: 37544 Number of extensions: 319955 Number of successful extensions: 874 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -