BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060650.seq (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B li... 30 1.7 At2g45350.1 68415.m05643 pentatricopeptide (PPR) repeat-containi... 29 2.9 At1g76850.1 68414.m08943 expressed protein 29 2.9 At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, put... 28 6.7 At4g33070.1 68417.m04711 pyruvate decarboxylase, putative strong... 28 6.7 >At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 656 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +3 Query: 72 CKGQLCLW--TYPWKIRHSN*EDIL 140 C LCLW + P KIRHSN E IL Sbjct: 519 CDFNLCLWCASLPKKIRHSNDEHIL 543 >At2g45350.1 68415.m05643 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 606 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +1 Query: 454 VIELAARVGFVREVFTGVGSLGKSLLTAHLLMNKCRNCIGFYIKC 588 V++ +R+GFV+ G L K+ L + L + C IG Y+KC Sbjct: 120 VLKACSRLGFVKGGMQIHGFLKKTGLWSDLFLQNC--LIGLYLKC 162 >At1g76850.1 68414.m08943 expressed protein Length = 1090 Score = 29.1 bits (62), Expect = 2.9 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 265 LNSIVSIMVSIPLERGENLILAFSQRLTKA-PGPKLGMVALQSLWRLYNNLEPNSPLRYH 441 L S V+I+ + LE E ++L F L K+ PK+ +L++ RL LEP S +H Sbjct: 380 LPSHVNILKRV-LEEVEKVMLEFKGTLYKSMEDPKIDFTSLENTVRLLLELEPESDPVWH 438 >At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, putative / extra sporogenous cells (ESP) identical to extra sporogenous cells [Arabidopsis thaliana] gi|23304947|emb|CAD42912; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1192 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 5/62 (8%) Frame = +1 Query: 295 IPLERGE-----NLILAFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYHVYYHVI 459 IP+E G+ L L + + P + LQ L YNNL + P + Y+H I Sbjct: 512 IPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQI 571 Query: 460 EL 465 E+ Sbjct: 572 EM 573 >At4g33070.1 68417.m04711 pyruvate decarboxylase, putative strong similarity to SP|P51846 Pyruvate decarboxylase isozyme 2 (EC 4.1.1.1) (PDC) {Nicotiana tabacum}; contains InterPro entry IPR000399: Pyruvate decarboxylase Length = 607 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/65 (24%), Positives = 29/65 (44%) Frame = +1 Query: 262 ILNSIVSIMVSIPLERGENLILAFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYH 441 I N S+ S+ L++ E I+ R+T A GP G + + +R + + Y Sbjct: 330 IFNDYSSVGYSLLLKK-EKAIVVQPDRITVANGPTFGCILMSDFFRELSKRVKRNETAYE 388 Query: 442 VYYHV 456 Y+ + Sbjct: 389 NYHRI 393 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,782,682 Number of Sequences: 28952 Number of extensions: 270110 Number of successful extensions: 805 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -