BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060648.seq (436 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U30888-1|AAB60365.1| 494|Homo sapiens tRNA-Guanine Transglycosy... 96 4e-20 BT007183-1|AAP35847.1| 494|Homo sapiens ubiquitin specific prot... 96 4e-20 BC003556-1|AAH03556.1| 494|Homo sapiens ubiquitin specific pept... 96 4e-20 AC002400-2|AAC05812.1| 533|Homo sapiens Gene product with simil... 39 0.009 BC013425-1|AAH13425.2| 318|Homo sapiens ubiquitin-like domain c... 36 0.060 AY444562-1|AAS68538.1| 318|Homo sapiens CTD-like phosphatase do... 36 0.060 AK057996-1|BAB71628.1| 318|Homo sapiens protein ( Homo sapiens ... 36 0.060 BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific pept... 33 0.32 BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein. 33 0.32 BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein. 33 0.32 BC106029-1|AAI06030.1| 799|Homo sapiens USP19 protein protein. 33 0.32 BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein. 33 0.32 BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific pept... 33 0.32 BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein. 33 0.32 AK057992-1|BAB71627.1| 706|Homo sapiens protein ( Homo sapiens ... 33 0.32 AB067478-1|BAB67784.1| 780|Homo sapiens KIAA1891 protein protein. 33 0.32 AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein. 33 0.32 D80012-1|BAA11507.1| 813|Homo sapiens KIAA0190 protein. 33 0.42 BX537402-1|CAD97644.1| 824|Homo sapiens hypothetical protein pr... 33 0.42 BC000263-1|AAH00263.1| 798|Homo sapiens ubiquitin specific pept... 33 0.42 AK128416-1|BAC87430.1| 303|Homo sapiens protein ( Homo sapiens ... 32 0.74 BX640815-1|CAE45893.1| 453|Homo sapiens hypothetical protein pr... 32 0.98 BC126898-1|AAI26899.1| 513|Homo sapiens USP22 protein protein. 32 0.98 BC110499-1|AAI10500.1| 512|Homo sapiens USP22 protein protein. 32 0.98 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 32 0.98 AB028986-1|BAA83015.1| 593|Homo sapiens KIAA1063 protein protein. 32 0.98 AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens ... 31 1.3 AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific prot... 31 2.3 AB037793-1|BAA92610.1| 773|Homo sapiens KIAA1372 protein protein. 31 2.3 BC004868-1|AAH04868.1| 508|Homo sapiens ubiquitin specific pept... 30 3.0 AK027820-1|BAB55392.1| 486|Homo sapiens protein ( Homo sapiens ... 30 3.0 AJ586136-1|CAE51936.1| 517|Homo sapiens ubiquitin-specific prot... 30 3.0 AJ586135-1|CAE51935.2| 1352|Homo sapiens ubiquitin-specific prot... 30 3.0 AJ583817-1|CAE47744.2| 1124|Homo sapiens ubiquitin specific prot... 30 3.0 Z81365-3|CAI43184.1| 913|Homo sapiens ubiquitin specific peptid... 30 4.0 BC130398-1|AAI30399.1| 912|Homo sapiens USP29 protein protein. 30 4.0 BC130394-1|AAI30395.1| 912|Homo sapiens USP29 protein protein. 30 4.0 BC101191-1|AAI01192.1| 913|Homo sapiens ubiquitin specific pept... 30 4.0 BC101190-1|AAI01191.1| 913|Homo sapiens ubiquitin specific pept... 30 4.0 BC101189-1|AAI01190.1| 913|Homo sapiens ubiquitin specific pept... 30 4.0 BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein. 30 4.0 BC069073-1|AAH69073.1| 913|Homo sapiens ubiquitin specific pept... 30 4.0 BC038983-1|AAH38983.1| 285|Homo sapiens USP36 protein protein. 30 4.0 BC037574-1|AAH37574.1| 366|Homo sapiens ubiquitin specific pept... 30 4.0 BC030704-1|AAH30704.1| 712|Homo sapiens ubiquitin specific pept... 30 4.0 BC027992-1|AAH27992.1| 959|Homo sapiens USP36 protein protein. 30 4.0 BC026072-1|AAH26072.1| 370|Homo sapiens ubiquitin specific pept... 30 4.0 BC016663-1|AAH16663.1| 828|Homo sapiens ubiquitin specific pept... 30 4.0 BC016487-1|AAH16487.1| 963|Homo sapiens Unknown (protein for IM... 30 4.0 AY169386-1|AAO34133.1| 548|Homo sapiens deubiquitinating enzyme... 30 4.0 AL355473-1|CAI16331.1| 370|Homo sapiens ubiquitin specific prot... 30 4.0 AL158062-1|CAH70555.1| 370|Homo sapiens ubiquitin specific prot... 30 4.0 AK024318-1|BAB14881.1| 366|Homo sapiens protein ( Homo sapiens ... 30 4.0 AK022913-1|BAB14306.1| 548|Homo sapiens protein ( Homo sapiens ... 30 4.0 AK022864-1|BAB14279.1| 828|Homo sapiens protein ( Homo sapiens ... 30 4.0 AK022614-1|BAB14133.1| 366|Homo sapiens protein ( Homo sapiens ... 30 4.0 AK001671-1|BAA91825.1| 954|Homo sapiens protein ( Homo sapiens ... 30 4.0 AF383173-1|AAL78315.1| 911|Homo sapiens pVHL-interacting deubiq... 30 4.0 AF383172-1|AAL78314.1| 942|Homo sapiens pVHL-interacting deubiq... 30 4.0 AF285593-1|AAK31972.1| 913|Homo sapiens ubiquitin specific prot... 30 4.0 AF229438-1|AAG10401.1| 922|Homo sapiens ubiquitin-specific proc... 30 4.0 AF022789-1|AAC23551.1| 355|Homo sapiens ubiquitin hydrolyzing e... 30 4.0 AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein. 30 4.0 AB029020-1|BAA83049.1| 980|Homo sapiens KIAA1097 protein protein. 30 4.0 D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein. 29 5.2 BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein pr... 29 5.2 BC125123-1|AAI25124.1| 952|Homo sapiens ubiquitin specific pept... 29 5.2 BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific pept... 29 5.2 BC014176-1|AAH14176.1| 640|Homo sapiens ubiquitin specific pept... 29 5.2 BC001749-1|AAH01749.1| 359|Homo sapiens wingless-type MMTV inte... 29 5.2 AY009399-1|AAG38659.1| 359|Homo sapiens WNT5b precursor protein. 29 5.2 AL365205-13|CAI13188.1| 640|Homo sapiens ubiquitin specific pep... 29 5.2 AL365205-12|CAI13186.1| 585|Homo sapiens ubiquitin specific pep... 29 5.2 AL365205-11|CAI13187.1| 688|Homo sapiens ubiquitin specific pep... 29 5.2 AJ586139-1|CAE51939.1| 688|Homo sapiens ubiquitin-specific prot... 29 5.2 AF153604-1|AAD41086.1| 981|Homo sapiens ubiquitin-specific prot... 29 5.2 AF106069-1|AAD52099.1| 952|Homo sapiens deubiquitinating enzyme... 29 5.2 AF013990-1|AAG28973.1| 902|Homo sapiens ubiquitin C-terminal hy... 29 5.2 AB060966-1|BAB62039.1| 359|Homo sapiens WNT5B protein. 29 5.2 AB011101-1|BAA25455.2| 952|Homo sapiens KIAA0529 protein protein. 29 5.2 U44839-1|AAC50450.1| 690|Homo sapiens UHX1 protein protein. 29 6.9 BC133009-1|AAI33010.1| 979|Homo sapiens ubiquitin specific pept... 29 6.9 BC133007-1|AAI33008.1| 979|Homo sapiens USP37 protein protein. 29 6.9 BC112901-1|AAI12902.1| 885|Homo sapiens USP37 protein protein. 29 6.9 BC063668-1|AAH63668.1| 923|Homo sapiens USP11 protein protein. 29 6.9 BC000350-1|AAH00350.4| 921|Homo sapiens USP11 protein protein. 29 6.9 AL832645-1|CAD89955.1| 979|Homo sapiens hypothetical protein pr... 29 6.9 AL096791-3|CAD20056.1| 690|Homo sapiens ubiquitin specific pept... 29 6.9 AL096791-2|CAI42996.1| 140|Homo sapiens ubiquitin specific pept... 29 6.9 AB073597-1|BAC20463.1| 921|Homo sapiens deubiquitinating enzyme... 29 6.9 AB046814-1|BAB13420.1| 931|Homo sapiens KIAA1594 protein protein. 29 6.9 X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein. 29 9.1 X63546-1|CAA45108.1| 786|Homo sapiens oncogene protein. 29 9.1 AY533200-1|AAS59847.1| 398|Homo sapiens deubiquitinating enzyme... 29 9.1 AY188990-1|AAO38845.1| 530|Homo sapiens deubiquitinating enzyme... 29 9.1 AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific prot... 29 9.1 AF544012-1|AAQ11742.1| 530|Homo sapiens deubiquitinating enzyme... 29 9.1 AF544011-1|AAQ11741.1| 530|Homo sapiens deubiquitinating enzyme... 29 9.1 AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific prot... 29 9.1 AF440755-1|AAN65363.1| 396|Homo sapiens ubiquitin specific prot... 29 9.1 AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific prot... 29 9.1 AF155116-1|AAD42882.1| 828|Homo sapiens NY-REN-60 antigen protein. 29 9.1 AF079564-1|AAC28392.1| 353|Homo sapiens ubiquitin-specific prot... 29 9.1 >U30888-1|AAB60365.1| 494|Homo sapiens tRNA-Guanine Transglycosylase protein. Length = 494 Score = 96.3 bits (229), Expect = 4e-20 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = +2 Query: 62 MPNVSVKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVVCKGVTLRDDTWGN 241 MP SV VKWGKE + VE+NTD+ P++FKAQ+FALTGVQP RQKV+ KG TL+DD WGN Sbjct: 1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN 60 Query: 242 FKL 250 K+ Sbjct: 61 IKI 63 Score = 64.5 bits (150), Expect = 2e-10 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = +1 Query: 178 PARETKSRLQRSHITG*HMGQF*IDDNALVLVMGSKXXDVPAAPVEQTRFVEDMNXAELA 357 PAR+ K ++ + G I + +L+MGS +P P +T FVEDM +LA Sbjct: 41 PARQ-KVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADA-LPEEPSAKTVFVEDMTEEQLA 98 Query: 358 TAMDMPEGLINXGNTCYMNXTVQXLK 435 +AM++P GL N GNTCYMN TVQ ++ Sbjct: 99 SAMELPCGLTNLGNTCYMNATVQCIR 124 >BT007183-1|AAP35847.1| 494|Homo sapiens ubiquitin specific protease 14 (tRNA-guanine transglycosylase) protein. Length = 494 Score = 96.3 bits (229), Expect = 4e-20 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = +2 Query: 62 MPNVSVKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVVCKGVTLRDDTWGN 241 MP SV VKWGKE + VE+NTD+ P++FKAQ+FALTGVQP RQKV+ KG TL+DD WGN Sbjct: 1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN 60 Query: 242 FKL 250 K+ Sbjct: 61 IKI 63 Score = 64.5 bits (150), Expect = 2e-10 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = +1 Query: 178 PARETKSRLQRSHITG*HMGQF*IDDNALVLVMGSKXXDVPAAPVEQTRFVEDMNXAELA 357 PAR+ K ++ + G I + +L+MGS +P P +T FVEDM +LA Sbjct: 41 PARQ-KVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADA-LPEEPSAKTVFVEDMTEEQLA 98 Query: 358 TAMDMPEGLINXGNTCYMNXTVQXLK 435 +AM++P GL N GNTCYMN TVQ ++ Sbjct: 99 SAMELPCGLTNLGNTCYMNATVQCIR 124 >BC003556-1|AAH03556.1| 494|Homo sapiens ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) protein. Length = 494 Score = 96.3 bits (229), Expect = 4e-20 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = +2 Query: 62 MPNVSVKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVVCKGVTLRDDTWGN 241 MP SV VKWGKE + VE+NTD+ P++FKAQ+FALTGVQP RQKV+ KG TL+DD WGN Sbjct: 1 MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN 60 Query: 242 FKL 250 K+ Sbjct: 61 IKI 63 Score = 64.5 bits (150), Expect = 2e-10 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = +1 Query: 178 PARETKSRLQRSHITG*HMGQF*IDDNALVLVMGSKXXDVPAAPVEQTRFVEDMNXAELA 357 PAR+ K ++ + G I + +L+MGS +P P +T FVEDM +LA Sbjct: 41 PARQ-KVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADA-LPEEPSAKTVFVEDMTEEQLA 98 Query: 358 TAMDMPEGLINXGNTCYMNXTVQXLK 435 +AM++P GL N GNTCYMN TVQ ++ Sbjct: 99 SAMELPCGLTNLGNTCYMNATVQCIR 124 >AC002400-2|AAC05812.1| 533|Homo sapiens Gene product with similarity to Ubiquitin binding enzyme protein. Length = 533 Score = 38.7 bits (86), Expect = 0.009 Identities = 21/61 (34%), Positives = 32/61 (52%) Frame = +2 Query: 71 VSVKVKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVVCKGVTLRDDTWGNFKL 250 V +K+ W K + DV+ D K +I ++TG+ P QKV+ KG+ D T K+ Sbjct: 310 VDLKIIWNKTKH-DVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKV 368 Query: 251 T 253 T Sbjct: 369 T 369 >BC013425-1|AAH13425.2| 318|Homo sapiens ubiquitin-like domain containing CTD phosphatase 1 protein. Length = 318 Score = 35.9 bits (79), Expect = 0.060 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 83 VKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVV 202 VKWG + Y ++ DD + K + LTGV PERQK++ Sbjct: 7 VKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLL 46 >AY444562-1|AAS68538.1| 318|Homo sapiens CTD-like phosphatase domain-containing protein protein. Length = 318 Score = 35.9 bits (79), Expect = 0.060 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 83 VKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVV 202 VKWG + Y ++ DD + K + LTGV PERQK++ Sbjct: 7 VKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLL 46 >AK057996-1|BAB71628.1| 318|Homo sapiens protein ( Homo sapiens cDNA FLJ25267 fis, clone STM05473. ). Length = 318 Score = 35.9 bits (79), Expect = 0.060 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 83 VKWGKEMYPDVEVNTDDEPVLFKAQIFALTGVQPERQKVV 202 VKWG + Y ++ DD + K + LTGV PERQK++ Sbjct: 7 VKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLL 46 >BC146752-1|AAI46753.1| 1318|Homo sapiens ubiquitin specific peptidase 19 protein. Length = 1318 Score = 33.5 bits (73), Expect = 0.32 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 295 VPAAPVEQTRFVEDMNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +P +PV VE+ E + GL+N GNTC+MN +Q L Sbjct: 471 MPHSPVSGDS-VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL 515 >BC142727-1|AAI42728.1| 1449|Homo sapiens USP19 protein protein. Length = 1449 Score = 33.5 bits (73), Expect = 0.32 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 295 VPAAPVEQTRFVEDMNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +P +PV VE+ E + GL+N GNTC+MN +Q L Sbjct: 639 MPHSPVSGDS-VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL 683 >BC142660-1|AAI42661.1| 1447|Homo sapiens USP19 protein protein. Length = 1447 Score = 33.5 bits (73), Expect = 0.32 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 295 VPAAPVEQTRFVEDMNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +P +PV VE+ E + GL+N GNTC+MN +Q L Sbjct: 637 MPHSPVSGDS-VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL 681 >BC106029-1|AAI06030.1| 799|Homo sapiens USP19 protein protein. Length = 799 Score = 33.5 bits (73), Expect = 0.32 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 295 VPAAPVEQTRFVEDMNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +P +PV VE+ E + GL+N GNTC+MN +Q L Sbjct: 617 MPHSPVSGDS-VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL 661 >BC082241-1|AAH82241.1| 1179|Homo sapiens USP19 protein protein. Length = 1179 Score = 33.5 bits (73), Expect = 0.32 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 295 VPAAPVEQTRFVEDMNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +P +PV VE+ E + GL+N GNTC+MN +Q L Sbjct: 369 MPHSPVSGDS-VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL 413 >BC068975-1|AAH68975.1| 1042|Homo sapiens ubiquitin specific peptidase 38 protein. Length = 1042 Score = 33.5 bits (73), Expect = 0.32 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTCYMN +Q L Sbjct: 446 GLINLGNTCYMNSVIQAL 463 >BC039115-1|AAH39115.1| 1004|Homo sapiens USP38 protein protein. Length = 1004 Score = 33.5 bits (73), Expect = 0.32 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTCYMN +Q L Sbjct: 446 GLINLGNTCYMNSVIQAL 463 >AK057992-1|BAB71627.1| 706|Homo sapiens protein ( Homo sapiens cDNA FLJ25263 fis, clone STM05053. ). Length = 706 Score = 33.5 bits (73), Expect = 0.32 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTCYMN +Q L Sbjct: 110 GLINLGNTCYMNSVIQAL 127 >AB067478-1|BAB67784.1| 780|Homo sapiens KIAA1891 protein protein. Length = 780 Score = 33.5 bits (73), Expect = 0.32 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTCYMN +Q L Sbjct: 184 GLINLGNTCYMNSVIQAL 201 >AB020698-1|BAA74914.1| 1371|Homo sapiens KIAA0891 protein protein. Length = 1371 Score = 33.5 bits (73), Expect = 0.32 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 295 VPAAPVEQTRFVEDMNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +P +PV VE+ E + GL+N GNTC+MN +Q L Sbjct: 524 MPHSPVSGDS-VEEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSL 568 >D80012-1|BAA11507.1| 813|Homo sapiens KIAA0190 protein. Length = 813 Score = 33.1 bits (72), Expect = 0.42 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 373 PEGLINXGNTCYMNXTVQXL 432 P GLIN GN CY+N T+Q L Sbjct: 429 PRGLINKGNWCYINATLQAL 448 >BX537402-1|CAD97644.1| 824|Homo sapiens hypothetical protein protein. Length = 824 Score = 33.1 bits (72), Expect = 0.42 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 373 PEGLINXGNTCYMNXTVQXL 432 P GLIN GN CY+N T+Q L Sbjct: 440 PRGLINKGNWCYINATLQAL 459 >BC000263-1|AAH00263.1| 798|Homo sapiens ubiquitin specific peptidase 10 protein. Length = 798 Score = 33.1 bits (72), Expect = 0.42 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +1 Query: 373 PEGLINXGNTCYMNXTVQXL 432 P GLIN GN CY+N T+Q L Sbjct: 414 PRGLINKGNWCYINATLQAL 433 >AK128416-1|BAC87430.1| 303|Homo sapiens protein ( Homo sapiens cDNA FLJ46559 fis, clone THYMU3040126. ). Length = 303 Score = 32.3 bits (70), Expect = 0.74 Identities = 12/51 (23%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 187 LWLDPCQCKYLRLEQYRFI-VCIHLHVWVHFLAPFYLH*NVRHFGLFCTFS 38 +++ C C Y R+ Y + VC+H H+++H H + C ++ Sbjct: 167 IYIHMCVCVYTRIYTYTCMCVCVHTHIYIHMYVCVCTHAYIHTHVYVCVYT 217 >BX640815-1|CAE45893.1| 453|Homo sapiens hypothetical protein protein. Length = 453 Score = 31.9 bits (69), Expect = 0.98 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTC+MN VQ L Sbjct: 105 GLINLGNTCFMNCIVQAL 122 >BC126898-1|AAI26899.1| 513|Homo sapiens USP22 protein protein. Length = 513 Score = 31.9 bits (69), Expect = 0.98 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTC+MN VQ L Sbjct: 165 GLINLGNTCFMNCIVQAL 182 >BC110499-1|AAI10500.1| 512|Homo sapiens USP22 protein protein. Length = 512 Score = 31.9 bits (69), Expect = 0.98 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTC+MN VQ L Sbjct: 164 GLINLGNTCFMNCIVQAL 181 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 31.9 bits (69), Expect = 0.98 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTC+MN VQ L Sbjct: 364 GLINLGNTCFMNCIVQAL 381 >AB028986-1|BAA83015.1| 593|Homo sapiens KIAA1063 protein protein. Length = 593 Score = 31.9 bits (69), Expect = 0.98 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTC+MN VQ L Sbjct: 245 GLINLGNTCFMNCIVQAL 262 >AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens cDNA FLJ42813 fis, clone BRCAN2012355. ). Length = 180 Score = 31.5 bits (68), Expect = 1.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 172 CQCKYLRLEQYRFIVCIHLHVWVHFLAPFYLH 77 C C Y + + VCIH+H+ VH Y H Sbjct: 8 CICMYTHMHMCTY-VCIHIHICVHIYICMYTH 38 >AJ586137-1|CAE51937.1| 1017|Homo sapiens ubiquitin-specific proteinase 35 protein. Length = 1017 Score = 30.7 bits (66), Expect = 2.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTCY+N +Q L Sbjct: 441 GLINLGNTCYVNSILQAL 458 >AB037793-1|BAA92610.1| 773|Homo sapiens KIAA1372 protein protein. Length = 773 Score = 30.7 bits (66), Expect = 2.3 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GLIN GNTCY+N +Q L Sbjct: 197 GLINLGNTCYVNSILQAL 214 >BC004868-1|AAH04868.1| 508|Homo sapiens ubiquitin specific peptidase 30 protein. Length = 508 Score = 30.3 bits (65), Expect = 3.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTC+MN +Q L Sbjct: 60 GLVNLGNTCFMNSLLQGL 77 >AK027820-1|BAB55392.1| 486|Homo sapiens protein ( Homo sapiens cDNA FLJ14914 fis, clone PLACE1006829, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15). ). Length = 486 Score = 30.3 bits (65), Expect = 3.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTC+MN +Q L Sbjct: 38 GLVNLGNTCFMNSLLQGL 55 >AJ586136-1|CAE51936.1| 517|Homo sapiens ubiquitin-specific proteinase 30 protein. Length = 517 Score = 30.3 bits (65), Expect = 3.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTC+MN +Q L Sbjct: 69 GLVNLGNTCFMNSLLQGL 86 >AJ586135-1|CAE51935.2| 1352|Homo sapiens ubiquitin-specific proteinase 31 protein. Length = 1352 Score = 30.3 bits (65), Expect = 3.0 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN T+Q L Sbjct: 129 GLRNHGNTCFMNATLQCL 146 >AJ583817-1|CAE47744.2| 1124|Homo sapiens ubiquitin specific proteinase 43 protein. Length = 1124 Score = 30.3 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 376 EGLINXGNTCYMNXTVQXL 432 +GL N GNTC+MN VQ L Sbjct: 101 QGLKNHGNTCFMNAVVQCL 119 >Z81365-3|CAI43184.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 296 GLPNLGNTCYMNAVLQSL 313 >BC130398-1|AAI30399.1| 912|Homo sapiens USP29 protein protein. Length = 912 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 361 AMDMPEGLINXGNTCYMNXTVQXL 432 + + +G N GNTCYMN +Q L Sbjct: 280 SQQLQQGFPNLGNTCYMNAVLQSL 303 >BC130394-1|AAI30395.1| 912|Homo sapiens USP29 protein protein. Length = 912 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 361 AMDMPEGLINXGNTCYMNXTVQXL 432 + + +G N GNTCYMN +Q L Sbjct: 280 SQQLQQGFPNLGNTCYMNAVLQSL 303 >BC101191-1|AAI01192.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 296 GLPNLGNTCYMNAVLQSL 313 >BC101190-1|AAI01191.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 296 GLPNLGNTCYMNAVLQSL 313 >BC101189-1|AAI01190.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 296 GLPNLGNTCYMNAVLQSL 313 >BC071582-1|AAH71582.1| 1123|Homo sapiens USP36 protein protein. Length = 1123 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >BC069073-1|AAH69073.1| 913|Homo sapiens ubiquitin specific peptidase 26 protein. Length = 913 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 296 GLPNLGNTCYMNAVLQSL 313 >BC038983-1|AAH38983.1| 285|Homo sapiens USP36 protein protein. Length = 285 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >BC037574-1|AAH37574.1| 366|Homo sapiens ubiquitin specific peptidase 46 protein. Length = 366 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 36 GLVNFGNTCYCNSVLQAL 53 >BC030704-1|AAH30704.1| 712|Homo sapiens ubiquitin specific peptidase 44 protein. Length = 712 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 274 GLRNLGNTCYMNSVLQVL 291 >BC027992-1|AAH27992.1| 959|Homo sapiens USP36 protein protein. Length = 959 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >BC026072-1|AAH26072.1| 370|Homo sapiens ubiquitin specific peptidase 12 protein. Length = 370 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 40 GLVNFGNTCYCNSVLQAL 57 >BC016663-1|AAH16663.1| 828|Homo sapiens ubiquitin specific peptidase 33 protein. Length = 828 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 186 GLKNIGNTCYMNAALQAL 203 >BC016487-1|AAH16487.1| 963|Homo sapiens Unknown (protein for IMAGE:3924730) protein. Length = 963 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >AY169386-1|AAO34133.1| 548|Homo sapiens deubiquitinating enzyme 1 protein. Length = 548 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >AL355473-1|CAI16331.1| 370|Homo sapiens ubiquitin specific protease 12 like 1 protein. Length = 370 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 40 GLVNFGNTCYCNSVLQAL 57 >AL158062-1|CAH70555.1| 370|Homo sapiens ubiquitin specific protease 12 like 1 protein. Length = 370 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 40 GLVNFGNTCYCNSVLQAL 57 >AK024318-1|BAB14881.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ14256 fis, clone PLACE1000007, weakly similar to PROBABLE UBIQUITIN CARBOXYL-TERMINAL HYDROLASE R10E11.3 (EC ). Length = 366 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 36 GLVNFGNTCYCNSVLQAL 53 >AK022913-1|BAB14306.1| 548|Homo sapiens protein ( Homo sapiens cDNA FLJ12851 fis, clone NT2RP2003401, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 548 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >AK022864-1|BAB14279.1| 828|Homo sapiens protein ( Homo sapiens cDNA FLJ12802 fis, clone NT2RP2002124, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 4 (EC 3.1.2.15). ). Length = 828 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 186 GLKNIGNTCYMNAALQAL 203 >AK022614-1|BAB14133.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ12552 fis, clone NT2RM4000712, moderately similar to Homo sapiens ubiquitin hydrolyzing enzyme I (UBH1) mRNA. ). Length = 366 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 36 GLVNFGNTCYCNSVLQAL 53 >AK001671-1|BAA91825.1| 954|Homo sapiens protein ( Homo sapiens cDNA FLJ10809 fis, clone NT2RP4000927, weakly similar to UBIQUITIN CARBOXYL-TERMINAL HYDROLASE DUB-1 (EC 3.1.2.15). ). Length = 954 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 123 GLHNLGNTCFLNATIQCL 140 >AF383173-1|AAL78315.1| 911|Homo sapiens pVHL-interacting deubiquitinating enzyme 1 type II protein. Length = 911 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 155 GLKNIGNTCYMNAALQAL 172 >AF383172-1|AAL78314.1| 942|Homo sapiens pVHL-interacting deubiquitinating enzyme 1 type I protein. Length = 942 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 186 GLKNIGNTCYMNAALQAL 203 >AF285593-1|AAK31972.1| 913|Homo sapiens ubiquitin specific protease 26 protein. Length = 913 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 296 GLPNLGNTCYMNAVLQSL 313 >AF229438-1|AAG10401.1| 922|Homo sapiens ubiquitin-specific processing protease protein. Length = 922 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 361 AMDMPEGLINXGNTCYMNXTVQXL 432 + + +G N GNTCYMN +Q L Sbjct: 280 SQQLQQGFPNLGNTCYMNAVLQSL 303 >AF022789-1|AAC23551.1| 355|Homo sapiens ubiquitin hydrolyzing enzyme I protein. Length = 355 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL+N GNTCY N +Q L Sbjct: 25 GLVNFGNTCYCNSVLQAL 42 >AB040886-1|BAA95977.1| 1123|Homo sapiens KIAA1453 protein protein. Length = 1123 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC++N T+Q L Sbjct: 125 GLHNLGNTCFLNATIQCL 142 >AB029020-1|BAA83049.1| 980|Homo sapiens KIAA1097 protein protein. Length = 980 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 224 GLKNIGNTCYMNAALQAL 241 >D29956-1|BAA06225.2| 1120|Homo sapiens KIAA0055 protein. Length = 1120 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 780 GLRNLGNTCYMNSILQCL 797 >BX537420-1|CAD97662.1| 1118|Homo sapiens hypothetical protein protein. Length = 1118 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 778 GLRNLGNTCYMNSILQCL 795 >BC125123-1|AAI25124.1| 952|Homo sapiens ubiquitin specific peptidase 15 protein. Length = 952 Score = 29.5 bits (63), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 261 GLSNLGNTCFMNSAIQCL 278 >BC110590-1|AAI10591.1| 1118|Homo sapiens ubiquitin specific peptidase 8 protein. Length = 1118 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 778 GLRNLGNTCYMNSILQCL 795 >BC014176-1|AAH14176.1| 640|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 640 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 254 GLRNLGNTCYMNSILQVL 271 >BC001749-1|AAH01749.1| 359|Homo sapiens wingless-type MMTV integration site family, member 5B protein. Length = 359 Score = 29.5 bits (63), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 363 GCSQFSXIHVFDKTCLFHWCCW 298 G +QF + V C FHWCC+ Sbjct: 322 GYNQFKSVQVERCHCKFHWCCF 343 >AY009399-1|AAG38659.1| 359|Homo sapiens WNT5b precursor protein. Length = 359 Score = 29.5 bits (63), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 363 GCSQFSXIHVFDKTCLFHWCCW 298 G +QF + V C FHWCC+ Sbjct: 322 GYNQFKSVQVERCHCKFHWCCF 343 >AL365205-13|CAI13188.1| 640|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 640 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 254 GLRNLGNTCYMNSILQVL 271 >AL365205-12|CAI13186.1| 585|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 585 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 254 GLRNLGNTCYMNSILQVL 271 >AL365205-11|CAI13187.1| 688|Homo sapiens ubiquitin specific peptidase 49 protein. Length = 688 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 254 GLRNLGNTCYMNSILQVL 271 >AJ586139-1|CAE51939.1| 688|Homo sapiens ubiquitin-specific proteinase 49 protein. Length = 688 Score = 29.5 bits (63), Expect = 5.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCYMN +Q L Sbjct: 254 GLRNLGNTCYMNSILQVL 271 >AF153604-1|AAD41086.1| 981|Homo sapiens ubiquitin-specific protease homolog protein. Length = 981 Score = 29.5 bits (63), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 290 GLSNLGNTCFMNSAIQCL 307 >AF106069-1|AAD52099.1| 952|Homo sapiens deubiquitinating enzyme protein. Length = 952 Score = 29.5 bits (63), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 261 GLSNLGNTCFMNSAIQCL 278 >AF013990-1|AAG28973.1| 902|Homo sapiens ubiquitin C-terminal hydrolase protein. Length = 902 Score = 29.5 bits (63), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 211 GLSNLGNTCFMNSAIQCL 228 >AB060966-1|BAB62039.1| 359|Homo sapiens WNT5B protein. Length = 359 Score = 29.5 bits (63), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 363 GCSQFSXIHVFDKTCLFHWCCW 298 G +QF + V C FHWCC+ Sbjct: 322 GYNQFKSVQVERCHCKFHWCCF 343 >AB011101-1|BAA25455.2| 952|Homo sapiens KIAA0529 protein protein. Length = 952 Score = 29.5 bits (63), Expect = 5.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 261 GLSNLGNTCFMNSAIQCL 278 >U44839-1|AAC50450.1| 690|Homo sapiens UHX1 protein protein. Length = 690 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >BC133009-1|AAI33010.1| 979|Homo sapiens ubiquitin specific peptidase 37 protein. Length = 979 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 376 EGLINXGNTCYMNXTVQXL 432 +G N GNTCYMN +Q L Sbjct: 341 QGFSNLGNTCYMNAILQSL 359 >BC133007-1|AAI33008.1| 979|Homo sapiens USP37 protein protein. Length = 979 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 376 EGLINXGNTCYMNXTVQXL 432 +G N GNTCYMN +Q L Sbjct: 341 QGFSNLGNTCYMNAILQSL 359 >BC112901-1|AAI12902.1| 885|Homo sapiens USP37 protein protein. Length = 885 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 376 EGLINXGNTCYMNXTVQXL 432 +G N GNTCYMN +Q L Sbjct: 269 QGFSNLGNTCYMNAILQSL 287 >BC063668-1|AAH63668.1| 923|Homo sapiens USP11 protein protein. Length = 923 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 270 GLTNLGNTCFMNSALQCL 287 >BC000350-1|AAH00350.4| 921|Homo sapiens USP11 protein protein. Length = 921 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 268 GLTNLGNTCFMNSALQCL 285 >AL832645-1|CAD89955.1| 979|Homo sapiens hypothetical protein protein. Length = 979 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 376 EGLINXGNTCYMNXTVQXL 432 +G N GNTCYMN +Q L Sbjct: 341 QGFSNLGNTCYMNAILQSL 359 >AL096791-3|CAD20056.1| 690|Homo sapiens ubiquitin specific peptidase 11 protein. Length = 690 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >AL096791-2|CAI42996.1| 140|Homo sapiens ubiquitin specific peptidase 11 protein. Length = 140 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 37 GLTNLGNTCFMNSALQCL 54 >AB073597-1|BAC20463.1| 921|Homo sapiens deubiquitinating enzyme protein. Length = 921 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTC+MN +Q L Sbjct: 268 GLTNLGNTCFMNSALQCL 285 >AB046814-1|BAB13420.1| 931|Homo sapiens KIAA1594 protein protein. Length = 931 Score = 29.1 bits (62), Expect = 6.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 376 EGLINXGNTCYMNXTVQXL 432 +G N GNTCYMN +Q L Sbjct: 293 QGFSNLGNTCYMNAILQSL 311 >X63547-2|CAA45111.1| 1089|Homo sapiens oncogene protein. Length = 1089 Score = 28.7 bits (61), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQ 426 GL N GNTC+MN ++Q Sbjct: 216 GLSNLGNTCFMNSSIQ 231 >X63546-1|CAA45108.1| 786|Homo sapiens oncogene protein. Length = 786 Score = 28.7 bits (61), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQ 426 GL N GNTC+MN ++Q Sbjct: 533 GLSNLGNTCFMNSSIQ 548 >AY533200-1|AAS59847.1| 398|Homo sapiens deubiquitinating enzyme DUB4 protein. Length = 398 Score = 28.7 bits (61), Expect = 9.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCY+N ++Q L Sbjct: 81 GLQNMGNTCYVNASLQCL 98 >AY188990-1|AAO38845.1| 530|Homo sapiens deubiquitinating enzyme 3 protein. Length = 530 Score = 28.7 bits (61), Expect = 9.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCY+N ++Q L Sbjct: 81 GLQNMGNTCYVNASLQCL 98 >AY143550-1|AAN38838.1| 1406|Homo sapiens ubiquitin-specific protease USP6 protein. Length = 1406 Score = 28.7 bits (61), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQ 426 GL N GNTC+MN ++Q Sbjct: 533 GLSNLGNTCFMNSSIQ 548 >AF544012-1|AAQ11742.1| 530|Homo sapiens deubiquitinating enzyme DUB2 protein. Length = 530 Score = 28.7 bits (61), Expect = 9.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCY+N ++Q L Sbjct: 81 GLQNMGNTCYVNASLQCL 98 >AF544011-1|AAQ11741.1| 530|Homo sapiens deubiquitinating enzyme DUB1 protein. Length = 530 Score = 28.7 bits (61), Expect = 9.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQXL 432 GL N GNTCY+N ++Q L Sbjct: 81 GLQNMGNTCYVNASLQCL 98 >AF533230-1|AAM97922.1| 1604|Homo sapiens ubiquitin-specific protease USP32 protein. Length = 1604 Score = 28.7 bits (61), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQ 426 GL N GNTC+MN ++Q Sbjct: 735 GLSNLGNTCFMNSSIQ 750 >AF440755-1|AAN65363.1| 396|Homo sapiens ubiquitin specific protease 2b protein. Length = 396 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 337 MNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +N A+ + + GL N GNTC+MN +Q L Sbjct: 45 LNKAKNSKSAQGLAGLRNLGNTCFMNSILQCL 76 >AF350251-1|AAK30207.1| 1274|Homo sapiens ubiquitin specific protease protein. Length = 1274 Score = 28.7 bits (61), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQ 426 GL N GNTC+MN ++Q Sbjct: 405 GLSNLGNTCFMNSSIQ 420 >AF155116-1|AAD42882.1| 828|Homo sapiens NY-REN-60 antigen protein. Length = 828 Score = 28.7 bits (61), Expect = 9.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 379 GLINXGNTCYMNXTVQ 426 GL N GNTC+MN ++Q Sbjct: 200 GLSNLGNTCFMNSSIQ 215 >AF079564-1|AAC28392.1| 353|Homo sapiens ubiquitin-specific protease UBP41 protein. Length = 353 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 337 MNXAELATAMDMPEGLINXGNTCYMNXTVQXL 432 +N A+ + + GL N GNTC+MN +Q L Sbjct: 2 LNKAKNSKSAQGLAGLRNLGNTCFMNSILQCL 33 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,143,582 Number of Sequences: 237096 Number of extensions: 1245591 Number of successful extensions: 2425 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 2378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2424 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -