BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060643.seq (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 25 0.58 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 22 4.1 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 22 4.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.5 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 25.0 bits (52), Expect = 0.58 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 555 CGDCGESNKSGDCDNTHSTDKVDYKRETLGKFHSS 451 CG E + DCD++ S +V Y R LG+ S+ Sbjct: 413 CGSLREIKEVSDCDSSESRKEV-YVRVPLGQRFSN 446 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 363 DPHFQWCHLLDLTTDRHC 310 DP +C L++T HC Sbjct: 60 DPSADYCLFLEMTLAHHC 77 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 279 TYHVHGQVNISNDDPLLSQ 335 ++H H V+ +N +PLLS+ Sbjct: 56 SFHDHVSVSNTNTEPLLSE 74 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 302 NLTVHVIRDTLTMVRAVNGS 243 NL +HV +DT T+ + G+ Sbjct: 592 NLEIHVTKDTDTLDNEMRGA 611 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/35 (22%), Positives = 13/35 (37%) Frame = -3 Query: 450 VVTQDLNLAAEPSAQLSPTQCYSGTAEKHDPHFQW 346 ++ +D+N A + Y E PH W Sbjct: 1 MIDKDMNSACMRGGSVRTLNNYQQVMEPRSPHTAW 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,633 Number of Sequences: 336 Number of extensions: 1636 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -