BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060640.seq (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 44 6e-06 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 44 6e-06 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 26 1.3 AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcrip... 25 1.7 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 23 9.0 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 43.6 bits (98), Expect = 6e-06 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+ NCE+ECEA+ +L+ C CV YY+P Sbjct: 361 YSRNNCELECEAKLILENCGCVLYYLP 387 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 43.6 bits (98), Expect = 6e-06 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+ NCE+ECEA+ +L+ C CV YY+P Sbjct: 361 YSRNNCELECEAKLILENCGCVLYYLP 387 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 463 VFTPINS*LKQACSFTRSCVNIFLSFDCSR 552 +F PIN+ C+F + C+ IF S+ C R Sbjct: 779 IFAPINN--TGDCTFLQDCIEIFCSW-CKR 805 >AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcription factor protein. Length = 185 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -2 Query: 437 SHKKHIHSFYMCVYFFYCLHGWTSSRPTLC*VVTGAHRH 321 SH H +YM Y Y H + ++ P + G H H Sbjct: 134 SHYSHNQYYYMQNYSNYSQHNFQTAGPISSGLYNGHHPH 172 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 205 LIYYRSRLSIFKQYIFFYKIDNNHTKRHRVC 297 L Y R + + YIF + D+ HT R C Sbjct: 146 LPYARQKFGDEEHYIFQHDNDSKHTSRTVKC 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,093 Number of Sequences: 2352 Number of extensions: 11040 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -