BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060640.seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U78181-1|AAB48981.1| 528|Homo sapiens sodium channel 2 protein. 34 0.41 U78180-1|AAB48980.1| 574|Homo sapiens sodium channel 2 protein. 34 0.41 EU078959-1|ABU48925.1| 528|Homo sapiens acid-sensing ion channe... 34 0.41 BC133707-1|AAI33708.1| 528|Homo sapiens amiloride-sensitive cat... 34 0.41 BC013891-1|AAH13891.2| 344|Homo sapiens ACCN2 protein protein. 34 0.41 U57352-1|AAB49182.1| 512|Homo sapiens sodium channel 1 protein. 33 0.95 U53212-1|AAC50498.1| 512|Homo sapiens degenerin channel MDEG pr... 33 0.95 U50352-1|AAC50432.1| 512|Homo sapiens sodium channel 1 protein. 33 0.95 BC075043-1|AAH75043.1| 512|Homo sapiens amiloride-sensitive cat... 33 0.95 BC075042-1|AAH75042.1| 512|Homo sapiens amiloride-sensitive cat... 33 0.95 AF195025-1|AAF19818.1| 549|Homo sapiens acid sensing ion channe... 31 3.8 AF195024-1|AAF19817.1| 543|Homo sapiens acid sensing ion channe... 31 3.8 AF095897-1|AAC64188.1| 531|Homo sapiens proton-gated cation cha... 31 3.8 AF057711-1|AAC62935.1| 531|Homo sapiens proton-gated cation cha... 31 3.8 AB209421-1|BAD92658.1| 446|Homo sapiens amiloride-sensitive cat... 31 3.8 BC073912-1|AAH73912.1| 296|Homo sapiens ACCN4 protein protein. 31 5.1 BC010439-1|AAH10439.1| 647|Homo sapiens amiloride-sensitive cat... 31 5.1 AJ408881-1|CAC51338.1| 539|Homo sapiens acid sensing ion channe... 31 5.1 AJ271643-1|CAB93980.1| 539|Homo sapiens putative acid-sensing i... 31 5.1 D86964-1|BAA13200.1| 1842|Homo sapiens KIAA0209 protein. 30 8.9 BC113457-1|AAI13458.1| 1830|Homo sapiens dedicator of cytokinesi... 30 8.9 BC104900-1|AAI04901.1| 1830|Homo sapiens dedicator of cytokinesi... 30 8.9 BC084556-1|AAH84556.1| 617|Homo sapiens DOCK2 protein protein. 30 8.9 >U78181-1|AAB48981.1| 528|Homo sapiens sodium channel 2 protein. Length = 528 Score = 34.3 bits (75), Expect = 0.41 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 100 TYTIKNCEMECEARALLDVCNCVHYYMP 17 +Y+I C ++CE R L++ CNC +MP Sbjct: 304 SYSITACRIDCETRYLVENCNCRMVHMP 331 >U78180-1|AAB48980.1| 574|Homo sapiens sodium channel 2 protein. Length = 574 Score = 34.3 bits (75), Expect = 0.41 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 100 TYTIKNCEMECEARALLDVCNCVHYYMP 17 +Y+I C ++CE R L++ CNC +MP Sbjct: 304 SYSITACRIDCETRYLVENCNCRMVHMP 331 >EU078959-1|ABU48925.1| 528|Homo sapiens acid-sensing ion channel 1a protein protein. Length = 528 Score = 34.3 bits (75), Expect = 0.41 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 100 TYTIKNCEMECEARALLDVCNCVHYYMP 17 +Y+I C ++CE R L++ CNC +MP Sbjct: 304 SYSITACRIDCETRYLVENCNCRMVHMP 331 >BC133707-1|AAI33708.1| 528|Homo sapiens amiloride-sensitive cation channel 2, neuronal protein. Length = 528 Score = 34.3 bits (75), Expect = 0.41 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 100 TYTIKNCEMECEARALLDVCNCVHYYMP 17 +Y+I C ++CE R L++ CNC +MP Sbjct: 304 SYSITACRIDCETRYLVENCNCRMVHMP 331 >BC013891-1|AAH13891.2| 344|Homo sapiens ACCN2 protein protein. Length = 344 Score = 34.3 bits (75), Expect = 0.41 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 100 TYTIKNCEMECEARALLDVCNCVHYYMP 17 +Y+I C ++CE R L++ CNC +MP Sbjct: 74 SYSITACRIDCETRYLVENCNCRMVHMP 101 >U57352-1|AAB49182.1| 512|Homo sapiens sodium channel 1 protein. Length = 512 Score = 33.1 bits (72), Expect = 0.95 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+I C ++CE R +++ CNC +MP Sbjct: 302 YSITACRIDCETRYIVENCNCRMVHMP 328 >U53212-1|AAC50498.1| 512|Homo sapiens degenerin channel MDEG protein. Length = 512 Score = 33.1 bits (72), Expect = 0.95 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+I C ++CE R +++ CNC +MP Sbjct: 302 YSITACRIDCETRYIVENCNCRMVHMP 328 >U50352-1|AAC50432.1| 512|Homo sapiens sodium channel 1 protein. Length = 512 Score = 33.1 bits (72), Expect = 0.95 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+I C ++CE R +++ CNC +MP Sbjct: 302 YSITACRIDCETRYIVENCNCRMVHMP 328 >BC075043-1|AAH75043.1| 512|Homo sapiens amiloride-sensitive cation channel 1, neuronal (degenerin), isoform 2 protein. Length = 512 Score = 33.1 bits (72), Expect = 0.95 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+I C ++CE R +++ CNC +MP Sbjct: 302 YSITACRIDCETRYIVENCNCRMVHMP 328 >BC075042-1|AAH75042.1| 512|Homo sapiens amiloride-sensitive cation channel 1, neuronal (degenerin) protein. Length = 512 Score = 33.1 bits (72), Expect = 0.95 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+I C ++CE R +++ CNC +MP Sbjct: 302 YSITACRIDCETRYIVENCNCRMVHMP 328 >AF195025-1|AAF19818.1| 549|Homo sapiens acid sensing ion channel 3 splice variant c protein. Length = 549 Score = 31.1 bits (67), Expect = 3.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 YT+ C + CE R + C C YMP Sbjct: 310 YTLMGCRLACETRYVARKCGCRMVYMP 336 >AF195024-1|AAF19817.1| 543|Homo sapiens acid sensing ion channel 3 splice variant b protein. Length = 543 Score = 31.1 bits (67), Expect = 3.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 YT+ C + CE R + C C YMP Sbjct: 310 YTLMGCRLACETRYVARKCGCRMVYMP 336 >AF095897-1|AAC64188.1| 531|Homo sapiens proton-gated cation channel ASIC3 protein. Length = 531 Score = 31.1 bits (67), Expect = 3.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 YT+ C + CE R + C C YMP Sbjct: 310 YTLMGCRLACETRYVARKCGCRMVYMP 336 >AF057711-1|AAC62935.1| 531|Homo sapiens proton-gated cation channel subunit protein. Length = 531 Score = 31.1 bits (67), Expect = 3.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 YT+ C + CE R + C C YMP Sbjct: 310 YTLMGCRLACETRYVARKCGCRMVYMP 336 >AB209421-1|BAD92658.1| 446|Homo sapiens amiloride-sensitive cation channel 3 isoform c variant protein. Length = 446 Score = 31.1 bits (67), Expect = 3.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 YT+ C + CE R + C C YMP Sbjct: 349 YTLMGCRLACETRYVARKCGCRMVYMP 375 >BC073912-1|AAH73912.1| 296|Homo sapiens ACCN4 protein protein. Length = 296 Score = 30.7 bits (66), Expect = 5.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y++ C + CE A+L C+C +MP Sbjct: 94 YSVSACRLRCEKEAVLQRCHCRMVHMP 120 >BC010439-1|AAH10439.1| 647|Homo sapiens amiloride-sensitive cation channel 4, pituitary protein. Length = 647 Score = 30.7 bits (66), Expect = 5.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y++ C + CE A+L C+C +MP Sbjct: 440 YSVSACRLRCEKEAVLQRCHCRMVHMP 466 >AJ408881-1|CAC51338.1| 539|Homo sapiens acid sensing ion channel 4 protein. Length = 539 Score = 30.7 bits (66), Expect = 5.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y++ C + CE A+L C+C +MP Sbjct: 313 YSVSACRLRCEKEAVLQRCHCRMVHMP 339 >AJ271643-1|CAB93980.1| 539|Homo sapiens putative acid-sensing ion channel protein. Length = 539 Score = 30.7 bits (66), Expect = 5.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y++ C + CE A+L C+C +MP Sbjct: 313 YSVSACRLRCEKEAVLQRCHCRMVHMP 339 >D86964-1|BAA13200.1| 1842|Homo sapiens KIAA0209 protein. Length = 1842 Score = 29.9 bits (64), Expect = 8.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 132 ETQLYTQEILVEAVALQEGFYHSIFNIL*VAPEYFQAIY 248 E +++ E+L + + Q FY SI IL P+YF Y Sbjct: 1321 EMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGY 1359 >BC113457-1|AAI13458.1| 1830|Homo sapiens dedicator of cytokinesis 2 protein. Length = 1830 Score = 29.9 bits (64), Expect = 8.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 132 ETQLYTQEILVEAVALQEGFYHSIFNIL*VAPEYFQAIY 248 E +++ E+L + + Q FY SI IL P+YF Y Sbjct: 1309 EMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGY 1347 >BC104900-1|AAI04901.1| 1830|Homo sapiens dedicator of cytokinesis 2 protein. Length = 1830 Score = 29.9 bits (64), Expect = 8.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 132 ETQLYTQEILVEAVALQEGFYHSIFNIL*VAPEYFQAIY 248 E +++ E+L + + Q FY SI IL P+YF Y Sbjct: 1309 EMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGY 1347 >BC084556-1|AAH84556.1| 617|Homo sapiens DOCK2 protein protein. Length = 617 Score = 29.9 bits (64), Expect = 8.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 132 ETQLYTQEILVEAVALQEGFYHSIFNIL*VAPEYFQAIY 248 E +++ E+L + + Q FY SI IL P+YF Y Sbjct: 96 EMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGY 134 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,475,442 Number of Sequences: 237096 Number of extensions: 1589615 Number of successful extensions: 2405 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2405 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -