BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060640.seq (687 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY226553-1|AAO47379.1| 606|Drosophila melanogaster pickpocket 2... 50 4e-06 AY226552-1|AAO47378.1| 632|Drosophila melanogaster pickpocket 2... 50 4e-06 AE014298-2487|AAF48671.3| 606|Drosophila melanogaster CG4805-PA... 50 4e-06 AE014298-2486|AAX52502.1| 632|Drosophila melanogaster CG4805-PB... 50 4e-06 AE014296-3568|AAS65090.1| 428|Drosophila melanogaster CG33289-P... 42 0.001 Y16240-1|CAA76129.1| 562|Drosophila melanogaster gonad-specific... 36 0.069 AF043264-1|AAC38824.1| 562|Drosophila melanogaster amiloride-se... 36 0.069 AE014297-128|AAF52108.2| 562|Drosophila melanogaster CG1058-PA ... 36 0.069 AY226543-1|AAO47369.1| 569|Drosophila melanogaster pickpocket 1... 34 0.16 AE014134-1079|AAF52371.1| 463|Drosophila melanogaster CG9501-PA... 34 0.16 AE013599-3400|AAF46849.2| 569|Drosophila melanogaster CG10972-P... 34 0.16 AE014296-1267|AAF50555.1| 602|Drosophila melanogaster CG8546-PA... 34 0.21 AE014298-539|ABI30967.1| 604|Drosophila melanogaster CG32792-PD... 33 0.28 Y16225-1|CAA76124.1| 606|Drosophila melanogaster Drosophila mul... 33 0.37 AY094859-1|AAM11212.1| 606|Drosophila melanogaster RE19290p pro... 33 0.37 AF043263-1|AAC38823.1| 606|Drosophila melanogaster amiloride-se... 33 0.37 AE014297-4735|AAF57143.3| 595|Drosophila melanogaster CG15555-P... 33 0.37 AE014134-2493|AAF53394.1| 606|Drosophila melanogaster CG3478-PA... 33 0.37 AE014297-3651|AAN14023.1| 542|Drosophila melanogaster CG31105-P... 33 0.48 AY226546-1|AAO47372.1| 531|Drosophila melanogaster pickpocket 1... 32 0.85 AE014134-1694|ABC65884.1| 531|Drosophila melanogaster CG34059-P... 32 0.85 AY226540-1|AAO47366.1| 573|Drosophila melanogaster pickpocket 7... 30 3.4 AE014134-1078|AAF52370.2| 573|Drosophila melanogaster CG9499-PA... 30 3.4 AE014297-4082|AAN14398.1| 439|Drosophila melanogaster CG31065-P... 29 4.5 AY226541-1|AAO47367.1| 485|Drosophila melanogaster pickpocket 1... 29 6.0 AE014134-1893|ABC65891.1| 485|Drosophila melanogaster CG34042-P... 29 6.0 AE013599-3620|AAM68252.1| 535|Drosophila melanogaster CG30181-P... 29 7.9 >AY226553-1|AAO47379.1| 606|Drosophila melanogaster pickpocket 28 short form protein. Length = 606 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 RTY+ KNCE+ECEA+ LL C+CV YY+P Sbjct: 349 RTYSRKNCELECEAKLLLRECSCVLYYLP 377 >AY226552-1|AAO47378.1| 632|Drosophila melanogaster pickpocket 28 long form protein. Length = 632 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 RTY+ KNCE+ECEA+ LL C+CV YY+P Sbjct: 375 RTYSRKNCELECEAKLLLRECSCVLYYLP 403 >AE014298-2487|AAF48671.3| 606|Drosophila melanogaster CG4805-PA, isoform A protein. Length = 606 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 RTY+ KNCE+ECEA+ LL C+CV YY+P Sbjct: 349 RTYSRKNCELECEAKLLLRECSCVLYYLP 377 >AE014298-2486|AAX52502.1| 632|Drosophila melanogaster CG4805-PB, isoform B protein. Length = 632 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 RTY+ KNCE+ECEA+ LL C+CV YY+P Sbjct: 375 RTYSRKNCELECEAKLLLRECSCVLYYLP 403 >AE014296-3568|AAS65090.1| 428|Drosophila melanogaster CG33289-PA protein. Length = 428 Score = 41.5 bits (93), Expect = 0.001 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R YT +NCE EC++ L +C+C+ YY+P Sbjct: 285 RYYTRRNCEAECDSMFFLRLCSCIPYYLP 313 >Y16240-1|CAA76129.1| 562|Drosophila melanogaster gonad-specific amiloride-sensitivesodium channel 1 protein. Length = 562 Score = 35.5 bits (78), Expect = 0.069 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 127 HEI*FMLPRTYTIKNCEMECEARALLDVCNCVHYYMP 17 HE + YT NC++EC A L C CV + MP Sbjct: 369 HERSLRFFKVYTESNCQLECLANFTLTKCGCVKFSMP 405 >AF043264-1|AAC38824.1| 562|Drosophila melanogaster amiloride-sensitive Na+ channel protein. Length = 562 Score = 35.5 bits (78), Expect = 0.069 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 127 HEI*FMLPRTYTIKNCEMECEARALLDVCNCVHYYMP 17 HE + YT NC++EC A L C CV + MP Sbjct: 369 HERSLRFFKVYTESNCQLECLANFTLTKCGCVKFSMP 405 >AE014297-128|AAF52108.2| 562|Drosophila melanogaster CG1058-PA protein. Length = 562 Score = 35.5 bits (78), Expect = 0.069 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 127 HEI*FMLPRTYTIKNCEMECEARALLDVCNCVHYYMP 17 HE + YT NC++EC A L C CV + MP Sbjct: 369 HERSLRFFKVYTESNCQLECLANFTLTKCGCVKFSMP 405 >AY226543-1|AAO47369.1| 569|Drosophila melanogaster pickpocket 12 protein. Length = 569 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R YT NCE EC A L D C+C+ + P Sbjct: 342 RIYTRLNCENECLAAFLYDTCSCIPFDHP 370 >AE014134-1079|AAF52371.1| 463|Drosophila melanogaster CG9501-PA protein. Length = 463 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCV--HYYMPS 14 Y ++NC+ EC+ R LL CNC +Y PS Sbjct: 329 YMLENCQAECQQRYLLRYCNCTVDLFYPPS 358 >AE013599-3400|AAF46849.2| 569|Drosophila melanogaster CG10972-PA protein. Length = 569 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R YT NCE EC A L D C+C+ + P Sbjct: 342 RIYTRLNCENECLAAFLYDTCSCIPFDHP 370 >AE014296-1267|AAF50555.1| 602|Drosophila melanogaster CG8546-PA protein. Length = 602 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 Y+ NCE+EC A L C CV + MP Sbjct: 408 YSQSNCELECLANFTLTKCGCVKFSMP 434 >AE014298-539|ABI30967.1| 604|Drosophila melanogaster CG32792-PD protein. Length = 604 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMP 17 YT +NC EC + L+ C CV +YMP Sbjct: 365 YTQRNCVAECLSGWLIRHCGCVTFYMP 391 >Y16225-1|CAA76124.1| 606|Drosophila melanogaster Drosophila multidendritic neuronssodium channel 1 protein. Length = 606 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R+Y+ NC+ EC A + C C ++MP Sbjct: 411 RSYSQSNCQTECLANYTVSKCGCAKFWMP 439 >AY094859-1|AAM11212.1| 606|Drosophila melanogaster RE19290p protein. Length = 606 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R+Y+ NC+ EC A + C C ++MP Sbjct: 411 RSYSQSNCQTECLANYTVSKCGCAKFWMP 439 >AF043263-1|AAC38823.1| 606|Drosophila melanogaster amiloride-sensitive Na+ channel protein. Length = 606 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R+Y+ NC+ EC A + C C ++MP Sbjct: 411 RSYSQSNCQTECLANYTVSKCGCAKFWMP 439 >AE014297-4735|AAF57143.3| 595|Drosophila melanogaster CG15555-PA protein. Length = 595 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -3 Query: 127 HEI*FMLPRTYTIKNCEMECEARALLDVCNCVHYYMPSK 11 +E+ ++ R YT C C A++++ +C CV + +P + Sbjct: 347 NEMPWIFARHYTFSKCISACRAQSVVSLCECVPFSLPHR 385 >AE014134-2493|AAF53394.1| 606|Drosophila melanogaster CG3478-PA protein. Length = 606 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 R+Y+ NC+ EC A + C C ++MP Sbjct: 411 RSYSQSNCQTECLANYTVSKCGCAKFWMP 439 >AE014297-3651|AAN14023.1| 542|Drosophila melanogaster CG31105-PA protein. Length = 542 Score = 32.7 bits (71), Expect = 0.48 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 100 TYTIKNCEMECEARALLDVCNCVHYYMP 17 +YT NC C R+++ +C C+ + MP Sbjct: 337 SYTFPNCITRCRIRSIIALCRCLPFQMP 364 >AY226546-1|AAO47372.1| 531|Drosophila melanogaster pickpocket 16 protein. Length = 531 Score = 31.9 bits (69), Expect = 0.85 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYM 20 R Y+ NC EC R +D+C C+ Y+ Sbjct: 357 RRYSFINCMFECRVRMTVDLCGCLPPYV 384 >AE014134-1694|ABC65884.1| 531|Drosophila melanogaster CG34059-PA protein. Length = 531 Score = 31.9 bits (69), Expect = 0.85 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYM 20 R Y+ NC EC R +D+C C+ Y+ Sbjct: 357 RRYSFINCMFECRVRMTVDLCGCLPPYV 384 >AY226540-1|AAO47366.1| 573|Drosophila melanogaster pickpocket 7 protein. Length = 573 Score = 29.9 bits (64), Expect = 3.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNC 35 Y I+NC+ EC L+ CNC Sbjct: 342 YMIENCQSECHQEYLVRYCNC 362 >AE014134-1078|AAF52370.2| 573|Drosophila melanogaster CG9499-PA protein. Length = 573 Score = 29.9 bits (64), Expect = 3.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNC 35 Y I+NC+ EC L+ CNC Sbjct: 342 YMIENCQSECHQEYLVRYCNC 362 >AE014297-4082|AAN14398.1| 439|Drosophila melanogaster CG31065-PA protein. Length = 439 Score = 29.5 bits (63), Expect = 4.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYM 20 Y+ C +EC LD CNC ++M Sbjct: 254 YSYSGCVVECTVLLQLDNCNCTSHFM 279 >AY226541-1|AAO47367.1| 485|Drosophila melanogaster pickpocket 10 protein. Length = 485 Score = 29.1 bits (62), Expect = 6.0 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMPSK 11 YT C+ EC +C C+ ++ P++ Sbjct: 324 YTRNICQQECRINLAYKICKCIPHFYPNR 352 >AE014134-1893|ABC65891.1| 485|Drosophila melanogaster CG34042-PB protein. Length = 485 Score = 29.1 bits (62), Expect = 6.0 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -3 Query: 97 YTIKNCEMECEARALLDVCNCVHYYMPSK 11 YT C+ EC +C C+ ++ P++ Sbjct: 324 YTRNICQQECRINLAYKICKCIPHFYPNR 352 >AE013599-3620|AAM68252.1| 535|Drosophila melanogaster CG30181-PA protein. Length = 535 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 103 RTYTIKNCEMECEARALLDVCNCVHYYMP 17 + Y+ C C A L++CNCV ++ P Sbjct: 324 KIYSKSLCLARCRAVMALEMCNCVPFFYP 352 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,183,979 Number of Sequences: 53049 Number of extensions: 484224 Number of successful extensions: 1013 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -