BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060639.seq (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 118 3e-27 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 118 3e-27 At2g19390.1 68415.m02262 expressed protein 30 1.3 At1g76010.1 68414.m08825 expressed protein 30 1.3 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 2.2 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 2.9 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 2.9 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 29 2.9 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 29 2.9 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 5.0 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 5.0 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 6.7 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 6.7 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 8.8 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 118 bits (285), Expect = 3e-27 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +3 Query: 255 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 419 AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 64 AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 58.4 bits (135), Expect = 4e-09 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +1 Query: 85 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKE 255 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+ Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKK 63 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/57 (36%), Positives = 35/57 (61%) Frame = +2 Query: 452 LXGSVAATGVPALVQARGHLLXRFPELXLVVADKVQEIKQDQNRVSIFLXGLXAWSD 622 + ++AAT VPALV ARGH + PE+ LVV+D + +++ + + L + A+ D Sbjct: 130 IVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKV-LKQIGAYDD 185 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 118 bits (285), Expect = 3e-27 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +3 Query: 255 AGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 419 AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 63 AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +1 Query: 76 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 249 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 250 KE 255 K+ Sbjct: 61 KK 62 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/57 (36%), Positives = 35/57 (61%) Frame = +2 Query: 452 LXGSVAATGVPALVQARGHLLXRFPELXLVVADKVQEIKQDQNRVSIFLXGLXAWSD 622 + ++AAT VPALV ARGH + PE+ LVV+D + +++ + + L + A+ D Sbjct: 129 IVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEAVEKTSAAIKV-LKQIGAYDD 184 >At2g19390.1 68415.m02262 expressed protein Length = 1211 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +1 Query: 409 GVGTVASTSDSGERPXRQRCCYRRSSARSG*RTLIXKISRAXLGCSRQSXRDQTRPKQ 582 G+GT S++ G+R R R ++S+R G KI R L ++ + + +PKQ Sbjct: 1064 GIGTQLSSNTKGKRSDRDRDGKGQASSRGG----TNKIGRPSLSNAKGERKTKAKPKQ 1117 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +3 Query: 249 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 377 QG G + G GR R R RGGG R G G F N G Sbjct: 303 QGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +1 Query: 100 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 246 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 390 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 271 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 390 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 271 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 249 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 383 +G+G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 249 QGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGR 383 +G+G + + G GR R +GGG H+ G+G +GGR Sbjct: 15 EGSGSREAGPVSGGGRGSQRGGFQQGGGQHQGGRGYTPQPQQGGR 59 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 225 LEAALLREQGAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 395 + AL+R + G + +AE + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRR-MGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 396 TKPW 407 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 151 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 246 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 151 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 246 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 378 HHDTCYRRHPDRTYEYHHHGHAEF 307 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 154 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 41 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -2 Query: 378 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 295 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,949,293 Number of Sequences: 28952 Number of extensions: 247819 Number of successful extensions: 795 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -