BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060636.seq (665 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g32190.1 68414.m03959 expressed protein 30 1.2 At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) / polyc... 28 6.4 At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p... 27 8.5 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 162 TGTCPESSCACPETSCACPETSCAC 236 +G C SC+CP+ C P SC C Sbjct: 298 SGLC-RPSCSCPKPRCPKPSCSCGC 321 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 Query: 168 TCPESSCACPETSCACPETSCAC 236 +CP+ C P SC C C C Sbjct: 306 SCPKPRCPKPSCSCGCGCGDCGC 328 >At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) / polycomb-group protein identical to polycomb group [Arabidopsis thaliana] GI:1903019 (curly leaf); contains Pfam profile PF00856: SET domain Length = 902 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 147 CVSQNTGTCPESSCACPETSCACPETSCACPES 245 C GTC E C CP+ SC C C +S Sbjct: 665 CPCLLNGTCCEKYCGCPK-SCKNRFRGCHCAKS 696 >At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol protease, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 452 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 147 CVSQNTGTCPESSCACPETSCACPETSCACPES 245 C+ + G C C E++ C + S CP+S Sbjct: 377 CLYEYNGKCYSWGCCPYESATCCDDGSSCCPQS 409 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,503,904 Number of Sequences: 28952 Number of extensions: 74771 Number of successful extensions: 255 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -