BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060635.seq (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y10129-1|CAA71216.1| 1274|Homo sapiens myosin binding protein C ... 32 2.2 X84075-1|CAA58882.1| 1274|Homo sapiens cardiac myosin-binding pr... 32 2.2 U91629-1|AAC04620.1| 1274|Homo sapiens cardiac myosin binding pr... 32 2.2 BC151211-1|AAI51212.1| 1274|Homo sapiens myosin binding protein ... 32 2.2 BC142685-1|AAI42686.1| 1274|Homo sapiens myosin binding protein ... 32 2.2 AY518390-1|AAR89909.1| 1273|Homo sapiens myosin binding protein ... 32 2.2 EF560722-1|ABQ59032.1| 1274|Homo sapiens MYBPC3 protein protein. 31 2.9 >Y10129-1|CAA71216.1| 1274|Homo sapiens myosin binding protein C gene protein. Length = 1274 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 526 WQLASLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 W++ LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 322 WEI--LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 >X84075-1|CAA58882.1| 1274|Homo sapiens cardiac myosin-binding protein C protein. Length = 1274 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 526 WQLASLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 W++ LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 322 WEI--LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 >U91629-1|AAC04620.1| 1274|Homo sapiens cardiac myosin binding protein-C protein. Length = 1274 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 526 WQLASLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 W++ LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 322 WEI--LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 >BC151211-1|AAI51212.1| 1274|Homo sapiens myosin binding protein C, cardiac protein. Length = 1274 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 526 WQLASLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 W++ LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 322 WEI--LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 >BC142685-1|AAI42686.1| 1274|Homo sapiens myosin binding protein C, cardiac protein. Length = 1274 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 526 WQLASLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 W++ LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 322 WEI--LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 >AY518390-1|AAR89909.1| 1273|Homo sapiens myosin binding protein C, cardiac protein. Length = 1273 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -2 Query: 526 WQLASLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 W++ LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 322 WEI--LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 >EF560722-1|ABQ59032.1| 1274|Homo sapiens MYBPC3 protein protein. Length = 1274 Score = 31.5 bits (68), Expect = 2.9 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -2 Query: 514 SLRFQPPSEREQVIFRQGYLPTRGLITHNKCKNKIYKKNT 395 +LR PPSE E++ F+ G RG++ K + KK+T Sbjct: 324 TLRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKST 363 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,007,935 Number of Sequences: 237096 Number of extensions: 1643545 Number of successful extensions: 2504 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2504 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -