BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060635.seq (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01520.1 68416.m00080 universal stress protein (USP) family p... 29 2.2 At4g11720.1 68417.m01870 hypothetical protein 28 5.0 >At3g01520.1 68416.m00080 universal stress protein (USP) family protein similar to ER6 protein (GI:5669654) [Lycopersicon esculentum]; contains Pfam profile PF00582: universal stress protein family Length = 175 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 115 SARCKN*FSYTFEHFLRRLT*KPKIILIHVDVI 17 S CK F +T E +R T KI+L+HV V+ Sbjct: 24 SISCKRAFEWTLEKIVRSNTSDFKILLLHVQVV 56 >At4g11720.1 68417.m01870 hypothetical protein Length = 658 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 284 GNLAVIIHIPSRLVIPQILGKIDFFISFSVP*IHSTYSVFFVNFIFALI-MCDESTS 451 GNL I L +P G + FF FS I++ + F+NF+F DE+ S Sbjct: 43 GNLNCSTKIVLNLAVPS--GSVRFFF-FSKTHIYTCFGFVFINFVFTCFGFVDETKS 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,415,875 Number of Sequences: 28952 Number of extensions: 256177 Number of successful extensions: 497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -