BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060632.seq (661 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.1 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 9.0 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 9.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 66 FIKHVVNFLKK 34 FIKHV+ FL+K Sbjct: 1499 FIKHVLQFLEK 1509 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 266 KSEGARSGLHGGCIKPPSQAL 328 KSE +++ +GGC S L Sbjct: 98 KSESSQAAKYGGCFSGESTVL 118 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 Query: 571 SKKGRGQRPXRLHRLWRNCGIFIMSYYHQA 482 SKK +G P + L CG Y++ A Sbjct: 173 SKKKKGPTPRQQEELCLVCGDRASGYHYNA 202 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,277 Number of Sequences: 336 Number of extensions: 3545 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -