BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060630.seq (551 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 27 0.082 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 23 2.3 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 23 2.3 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 7.2 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 7.2 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 27.5 bits (58), Expect = 0.082 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 270 PIQYFEEANFPDYVQQGVKTMGYKEPDAIQ 359 PI FE + ++ + VK GY +P AIQ Sbjct: 156 PITSFETSGLRPHLLENVKKSGYTKPTAIQ 185 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 22.6 bits (46), Expect = 2.3 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 249 KWVEVHNPIQYFEE 290 KW+ ++N +QY +E Sbjct: 106 KWIRLNNNLQYIDE 119 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 22.6 bits (46), Expect = 2.3 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 Query: 249 KWVEVHNPIQYFEE 290 KW+ ++N +QY +E Sbjct: 106 KWIRLNNNLQYIDE 119 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -3 Query: 327 SLHLVAHNQENLLLQSIE*DYEPQPTYSYLVIXSVLFDFI 208 S +++H + + +Y+ SYL+I VLF + Sbjct: 119 SFDMLSHVDVSFIKAGFRLEYKQLLKRSYLIISFVLFSLL 158 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = -3 Query: 327 SLHLVAHNQENLLLQSIE*DYEPQPTYSYLVIXSVLFDFI 208 S +++H + + +Y+ SYL+I VLF + Sbjct: 119 SFDMLSHVDVSFIKAGFRLEYKQLLKRSYLIISFVLFSLL 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,315 Number of Sequences: 336 Number of extensions: 2200 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -