BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV060630.seq
(551 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 30 0.014
U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.3
AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.3
>DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein.
Length = 630
Score = 30.3 bits (65), Expect = 0.014
Identities = 13/33 (39%), Positives = 18/33 (54%)
Frame = +3
Query: 261 VHNPIQYFEEANFPDYVQQGVKTMGYKEPDAIQ 359
V PI+ FE A + V +K GYK+P +Q
Sbjct: 191 VPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQ 223
>U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive
opsin protein.
Length = 377
Score = 21.0 bits (42), Expect = 8.3
Identities = 5/9 (55%), Positives = 7/9 (77%)
Frame = +3
Query: 246 CKWVEVHNP 272
CKW+ +H P
Sbjct: 351 CKWMGIHEP 359
>AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin
protein.
Length = 377
Score = 21.0 bits (42), Expect = 8.3
Identities = 5/9 (55%), Positives = 7/9 (77%)
Frame = +3
Query: 246 CKWVEVHNP 272
CKW+ +H P
Sbjct: 351 CKWMGIHEP 359
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,521
Number of Sequences: 438
Number of extensions: 2590
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15827139
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -