BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060630.seq (551 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 30 0.014 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.3 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.3 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 30.3 bits (65), Expect = 0.014 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 261 VHNPIQYFEEANFPDYVQQGVKTMGYKEPDAIQ 359 V PI+ FE A + V +K GYK+P +Q Sbjct: 191 VPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQ 223 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.0 bits (42), Expect = 8.3 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +3 Query: 246 CKWVEVHNP 272 CKW+ +H P Sbjct: 351 CKWMGIHEP 359 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.0 bits (42), Expect = 8.3 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +3 Query: 246 CKWVEVHNP 272 CKW+ +H P Sbjct: 351 CKWMGIHEP 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,521 Number of Sequences: 438 Number of extensions: 2590 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -