BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060629.seq (634 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0827 + 32260313-32260525,32261862-32262716 30 1.8 08_02_0786 + 21198247-21198921 29 4.1 03_03_0277 + 16116017-16117424,16117461-16117660,16117739-161178... 29 4.1 02_04_0078 + 19507705-19508169 29 4.1 12_02_0474 + 19482150-19482152,19482205-19482336,19482513-194826... 28 7.1 04_04_0383 - 24851496-24851681,24851785-24851882,24851964-248520... 28 7.1 08_01_0963 - 9661699-9661760,9662095-9662818,9662860-9663265,966... 27 9.4 >01_06_0827 + 32260313-32260525,32261862-32262716 Length = 355 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 458 ERESNPMEALCRSGCGFTAIPPQTDFAQFCFKE 556 ++ S LC SGCGF P D C+++ Sbjct: 195 QQASAGQPVLCASGCGFYGNPATLDMCSVCYRQ 227 >08_02_0786 + 21198247-21198921 Length = 224 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 482 ALCRSGCGFTAIPPQTDFAQFCFKEALK 565 ALC SGCGF + C+++ LK Sbjct: 79 ALCSSGCGFFGSKETNNMCSKCYRDHLK 106 >03_03_0277 + 16116017-16117424,16117461-16117660,16117739-16117816, 16118381-16118533,16118969-16119280,16119390-16119563, 16120411-16120498,16120598-16120611 Length = 808 Score = 28.7 bits (61), Expect = 4.1 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 1/87 (1%) Frame = -3 Query: 344 SAVITMRTNLLSNVGQVTSG-LCSAQQFSLL*YTIATSVSGPLKDTLLLKKRVSNQTNVF 168 SA M L+SNV + +G L ++ + T G K T + KR+ N ++ Sbjct: 548 SANTVMGRELISNVQVINNGDLEDLREIGS--GSFGTVFHGRWKGTDVAIKRIKNSCFMY 605 Query: 167 PSAQSLQLTNKRHHVCAVVVSIHRHHN 87 PS+Q+ +L + A++ +H H N Sbjct: 606 PSSQADKLITEFWREAAIISKLH-HPN 631 >02_04_0078 + 19507705-19508169 Length = 154 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 485 LCRSGCGFTAIPPQTDFAQFCFKEALKKKTTA 580 LC + CGF P D C+++ +++TA Sbjct: 14 LCANNCGFFGSPATLDLCSKCYRDRQGRESTA 45 >12_02_0474 + 19482150-19482152,19482205-19482336,19482513-19482602, 19482649-19482708,19482959-19483058,19483137-19483234, 19483351-19483525,19484167-19484270 Length = 253 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 438 HFNNKFQTLH*CLTSDCTKSTL 373 HF+ + TLH C TSDC K L Sbjct: 165 HFSRPWFTLHPCGTSDCMKLLL 186 >04_04_0383 - 24851496-24851681,24851785-24851882,24851964-24852063, 24852741-24852899 Length = 180 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 438 HFNNKFQTLH*CLTSDCTKSTL 373 HF+ + TLH C TSDC K L Sbjct: 123 HFSRPWFTLHPCGTSDCMKLLL 144 >08_01_0963 - 9661699-9661760,9662095-9662818,9662860-9663265, 9663488-9665037 Length = 913 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 225 TFEGHTVVEKESFEPNKCLSKCAVPSAHKQATPRLCGCS 109 T+E +++ SFE NK LS+ +PS+ + + G S Sbjct: 32 TYEAEDILDLASFEGNKLLSQNPLPSSSSRNSTGCTGFS 70 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,439,861 Number of Sequences: 37544 Number of extensions: 293440 Number of successful extensions: 662 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -