BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060628.seq (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 25 2.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 7.7 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 24.6 bits (51), Expect = 2.5 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 395 HHQTV*ITMVLIDLYR*LVDQAGF-VLPQSINXRPN 291 H Q + + L+DLY LVD AG +P+ RP+ Sbjct: 361 HQQKIDNVVELLDLYSTLVDLAGLPPVPRCDEQRPH 396 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 Query: 531 VSTIKTMHKCVPIFSLCL 478 +ST++++H C+ F+L L Sbjct: 198 ISTLRSLHDCISSFTLRL 215 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,545 Number of Sequences: 2352 Number of extensions: 9194 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -