BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060622.seq (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 35 0.003 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 26 0.96 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 25 2.9 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 24 5.1 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 23 6.8 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 6.8 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 9.0 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 34.7 bits (76), Expect = 0.003 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +3 Query: 510 GKNLVGVLQTGSGKTLAYILPAIVHI 587 G++L+ QTGSGKT A++LP I H+ Sbjct: 211 GRDLMACAQTGSGKTAAFMLPMIHHL 236 Score = 33.9 bits (74), Expect = 0.005 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 361 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAM 507 +V VSG + ++ FE + + V V+ Y +PTPIQ PI + Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIIL 209 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.2 bits (55), Expect = 0.96 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 114 TVVPNLEEATNSAIIRLDLATVAVDLEDLEDLVGKKNSLE 233 T++ +L+E S + LDL +D +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 657 NSLVRRQDQSNRTI 616 NS+VRR D+SN TI Sbjct: 543 NSIVRRSDESNLTI 556 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.8 bits (49), Expect = 5.1 Identities = 17/70 (24%), Positives = 26/70 (37%) Frame = +1 Query: 235 SEHASPSWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEE 414 SE S +++P Y+P P VL + V E + ++ + V EE Sbjct: 97 SEDVESSIPVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQEE 156 Query: 415 ANFPDYVQQG 444 A Y G Sbjct: 157 AQIDVYHVDG 166 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 659 LTLWLGAKTKAIGPSPLRNRRLV--VYVHNGWQDVGQRF 549 LT+WLG K + LRN+ + ++V W D R+ Sbjct: 55 LTVWLGLKLSQLIEVSLRNQVMTTNLWVKQKWFDYKLRW 93 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 523 LAYFKRVPAKRWPTSCQ 573 +A F +PA RWP C+ Sbjct: 169 VAIFVPLPADRWPRVCE 185 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 313 VLKRSPYEVEEYRNNHEVTVSGVEVHNPIQY 405 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,694 Number of Sequences: 2352 Number of extensions: 13445 Number of successful extensions: 40 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -