BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060619.seq (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 77 5e-16 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.0 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 5.3 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.2 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 9.2 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 77.0 bits (181), Expect = 5e-16 Identities = 42/61 (68%), Positives = 46/61 (75%) Frame = +3 Query: 510 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGSLTKXGYWENEIVLIF*TSGXR 689 PAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYG L K E VLIF G Sbjct: 7 PAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYG-LDKNLKGERN-VLIFDLGGGT 64 Query: 690 Y 692 + Sbjct: 65 F 65 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.0 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 73 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 174 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 187 SVLCCVHRHRASHRRCRQEPGGENPNNTI 273 SVL C + R C P G N N ++ Sbjct: 10 SVLGCAYTQRTKCAACLDSPDGMNGNESL 38 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = +3 Query: 171 RATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHNIRC 281 + G L + S + +VSS++PP + ++ C Sbjct: 744 KVAGTLGAVQPSSSEAVSSKLPPTAEPEHSESSDVEC 780 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.0 bits (47), Expect = 9.2 Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 1/81 (1%) Frame = +3 Query: 96 ESIWVPRTLALVSSSTGRWRSSPT-TRATGPLRLMLRSQTPSVSSEMPPRTRWREPQQHN 272 E++W + A S T W+ RAT L L+ Q P + + W Q+H+ Sbjct: 30 ENLWKFESTAAPESLTETWKEGDAKARATIAL-LVDDCQHPLIRDCKTAKGTWDALQKHH 88 Query: 273 IRCQTSHRT*VRRCYCASRHE 335 + S + + + C + ++ Sbjct: 89 QKTTMSTKVSLLKKLCKAEYD 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,082 Number of Sequences: 2352 Number of extensions: 17696 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -