BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060618.seq (669 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 5.2 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 9.1 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 90 NMTRNMTRLYFRPPLPKDSVSDPPSF 167 N+T + +R P P+ S PP + Sbjct: 31 NLTTSKLLYTYRQPYPRQKKSHPPQW 56 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = -2 Query: 620 FVMVSDGTKQTERDRMEFGLHTQTSWEDDLYC 525 + ++D K+ ++ LH Q W + YC Sbjct: 280 YYQLTDLYKKIKKAFPPLSLHGQLLWREFFYC 311 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,774 Number of Sequences: 336 Number of extensions: 3834 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -