BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060618.seq (669 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26213| Best HMM Match : CITED (HMM E-Value=2.5) 28 6.0 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_26213| Best HMM Match : CITED (HMM E-Value=2.5) Length = 172 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +2 Query: 83 APKHDSKYDPTLLSASI---AKRLRFRPSFLPYRLSPSDESLA 202 AP K D T L A + A R R PSF P LSP LA Sbjct: 104 APGPGEKGDHTALKAGLSELAPRARSSPSFFPMALSPIPTPLA 146 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 244 PNHKFLFSPTFSLNVSISMSTHSFPTRLKLSSKRTQIVRIPTGGTLLSAYFQ 399 P+ K L L S++ S T + Q+ IPTGG LS YF+ Sbjct: 1082 PDAKVLPPIASFLKPSVNGSMQFHTTNVTSKDVTIQVTLIPTGGKELSVYFR 1133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,072,143 Number of Sequences: 59808 Number of extensions: 517652 Number of successful extensions: 1208 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1208 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -