BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060617.seq (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.3 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 318 IGYSTCIITRSFTFYFCCYSALTLXRLI 235 IGY+TC+++ Y+ A L L+ Sbjct: 100 IGYATCVLSCWTNIYYIIILAWALFYLL 127 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 318 IGYSTCIITRSFTFYFCCYSALTLXRLI 235 IGY+TC+++ Y+ A L L+ Sbjct: 153 IGYATCVLSCWTNIYYIIILAWALFYLL 180 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 113 TEVEKKTGLPLTALYETIRMEKFFN-NAGLSNR 18 ++ E+K G Y+T+ +EK F+ N L+ R Sbjct: 266 SQFERKRGRQTYTRYQTLELEKEFHYNRYLTRR 298 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,798 Number of Sequences: 438 Number of extensions: 3617 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -