BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060616.seq (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.6 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 4.9 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 6.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 83 SSYRPPLLHQNQHYKSIWTFDLHAPY 160 + Y P+L QN + ++ T+D H + Sbjct: 1571 AGYDVPVLAQNLDWVAVMTYDFHGQW 1596 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 4.9 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 177 YDDNTDYNIAVIYSEYDITTQTVFVSVMIL*YHLHLLLTPIGT 305 +D T+ NIA S + T+F+S + +L L+P+ T Sbjct: 93 FDKFTNRNIATNESADPLAFHTLFISKDAVWRNLRTKLSPVFT 135 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.4 bits (43), Expect = 6.5 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = -3 Query: 328 ERKEWRNGVPIGVSRRW 278 + ++WRN P + RW Sbjct: 360 DEQQWRNNQPSTSNNRW 376 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,637 Number of Sequences: 336 Number of extensions: 2308 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -