BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060616.seq (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34605| Best HMM Match : APG6 (HMM E-Value=0.94) 31 0.59 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 29 3.1 >SB_34605| Best HMM Match : APG6 (HMM E-Value=0.94) Length = 1047 Score = 31.5 bits (68), Expect = 0.59 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 116 GFDVAMEVYKMRWNGKPLHFLPFQNNGLTMLRLV 15 G + AME K+ WN F+P+++ G+++L V Sbjct: 795 GLEKAMEKMKVEWNDMFFEFVPYRDTGVSILSAV 828 >SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) Length = 635 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 120 ITSQFGPLTCMRLTGEPGTYDDNTDYNIAV-IYSEYDITTQTV 245 + F P + +R+ EPG Y ++ + +AV +YS ++ + +V Sbjct: 437 LEEHFPPSSGVRIIAEPGRYYSSSSFTLAVNVYSRREVQSSSV 479 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,321,643 Number of Sequences: 59808 Number of extensions: 319627 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -