BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060616.seq (633 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024751-3|AAK21513.2| 440|Caenorhabditis elegans Hypothetical ... 30 1.6 Z99171-7|CAB16312.1| 188|Caenorhabditis elegans Hypothetical pr... 27 8.4 >AC024751-3|AAK21513.2| 440|Caenorhabditis elegans Hypothetical protein Y18H1A.10 protein. Length = 440 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -2 Query: 98 EVYKMRWNGKP--LHFLPFQNNG 36 EV+ WNG+P + LPF+NNG Sbjct: 118 EVFSTVWNGRPVAIKVLPFENNG 140 >Z99171-7|CAB16312.1| 188|Caenorhabditis elegans Hypothetical protein F47G4.8 protein. Length = 188 Score = 27.5 bits (58), Expect = 8.4 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 162 GEPGTYDDNTDYNIAVIYSEYDITTQTVFVSVMIL*Y-HLHLLLTPIGT 305 G+PGTY ++ +++ S + I T + +L Y HL + PI T Sbjct: 33 GQPGTYSTYSNPDVSFGKSAWTIATVWILACFHLLFYFRAHLAIQPITT 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,603,681 Number of Sequences: 27780 Number of extensions: 229923 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -