BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060616.seq (633 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66235.1 68414.m07518 expressed protein ; expression supporte... 29 2.6 At1g08470.1 68414.m00938 strictosidine synthase family protein s... 28 4.5 >At1g66235.1 68414.m07518 expressed protein ; expression supported by MPSS Length = 265 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 41 CFGTEENGAAFHSISSYRPPLLHQNQHYKSIWTFD 145 C +GA+ I + +L Q++H+KS W FD Sbjct: 63 CENRRSSGASSDDIFNQAKEMLMQDKHFKSGWKFD 97 >At1g08470.1 68414.m00938 strictosidine synthase family protein similar to strictosidine synthase [Rauvolfia serpentina][SP|P15324] Length = 390 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 16 TNLSMVRPLFWNGRKWSGFPFHLIL*TSIATSKPTL 123 T ++ R LFWNG +W+ F + + + KP+L Sbjct: 84 TGVADGRILFWNGTRWTDFAYTSNNRSELCDPKPSL 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,975,034 Number of Sequences: 28952 Number of extensions: 215166 Number of successful extensions: 508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -