BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060613.seq (683 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.14c |sti1||chaperone activator Sti1 |Schizosaccharomyces... 26 5.8 SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccha... 25 7.7 >SPCC645.14c |sti1||chaperone activator Sti1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 591 Score = 25.8 bits (54), Expect = 5.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 523 FAKRGQVYLKLNKPNACMTDCXHA 594 F R YLK+ P C+ DC A Sbjct: 436 FGNRAAAYLKVMAPAECIRDCNKA 459 >SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccharomyces pombe|chr 1|||Manual Length = 549 Score = 25.4 bits (53), Expect = 7.7 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +3 Query: 99 LKSFVEICKTQPQLLHHPQLXFF--KDYLISLGVSLPTATFGAK 224 L+S++ T P LL+ P+L F DY S ++ T G K Sbjct: 183 LQSWLNYVSTNPNLLYDPELQLFVESDYGYSPLINTGNPTSGLK 226 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,095,959 Number of Sequences: 5004 Number of extensions: 32275 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -