BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060613.seq (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 35 0.053 SB_56887| Best HMM Match : TolA (HMM E-Value=0.66) 28 6.1 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 35.1 bits (77), Expect = 0.053 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 523 FAKRGQVYLKLNKPNACMTDCXHA*XLSCDSXTALTNFRGASXXGLG 663 FAKR ++++ KPNA + DC A ++ DS + +RG + LG Sbjct: 85 FAKRASCFIRMKKPNAAIRDCDKAAQINPDS-AQIYKWRGRAHEFLG 130 >SB_56887| Best HMM Match : TolA (HMM E-Value=0.66) Length = 404 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 344 DQTDESQDMGDPNKEVTEXXXDESDXKRSEAMRAFSEQKXDEA 472 D+TD+ D D KE + +ESD S + + S D++ Sbjct: 206 DKTDDDDDKKDAEKEDKDESGNESDSSSSSSSSSSSSSDDDDS 248 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,794,903 Number of Sequences: 59808 Number of extensions: 242187 Number of successful extensions: 428 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -