BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060613.seq (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 1.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.3 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 362 QDMGDPNKEVTEXXXDESDXKRSEAMRAF--SEQKXDE 469 Q G P +E + DESD + ++ + F S DE Sbjct: 76 QQAGKPKEETDDKDDDESDNENIKSQKEFPNSSSSDDE 113 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 537 PGVSQTKQTKCMYDGLXTCLRXEL*QRHCTH 629 PG+ T+ + M++ L L+ L Q H H Sbjct: 351 PGLRNTELVERMHNKLRNALQTVLAQNHPQH 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,526 Number of Sequences: 438 Number of extensions: 2246 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -