BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060609.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 36 2e-04 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 1.8 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 36.3 bits (80), Expect = 2e-04 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +1 Query: 361 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 EV V+G + PI FE + ++ + VK GY +PT IQ P+ + R Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGR 196 Score = 33.1 bits (72), Expect = 0.002 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 447 KDNGLQRTDAYSSSRLADSYVGKNLVGVVQTGSGKTLAYILPAI 578 K +G + A + G++L+ QTGSGKT A++LP I Sbjct: 174 KKSGYTKPTAIQKYAIPVILSGRDLMSCAQTGSGKTAAFMLPII 217 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 603 YSER*WSDCFGLGALPESLAQPIQ 674 YS W+D G G E LA+ +Q Sbjct: 128 YSGYVWTDILGFGYFREYLAEAVQ 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,954 Number of Sequences: 336 Number of extensions: 3202 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -