BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060609.seq (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 4e-18 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 61 9e-10 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 55 5e-08 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 52 6e-07 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 51 8e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 47 1e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 38 0.006 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 38 0.008 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 33 0.16 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 33 0.22 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 31 0.87 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 31 1.1 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 31 1.1 SB_51385| Best HMM Match : DEAD (HMM E-Value=0.00031) 30 1.5 SB_34740| Best HMM Match : DEAD (HMM E-Value=0.00031) 30 1.5 SB_22560| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 2.0 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 29 2.7 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 29 3.5 SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 28 6.1 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_19645| Best HMM Match : Smr (HMM E-Value=8.2) 28 8.1 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 8.1 SB_58343| Best HMM Match : ELM2 (HMM E-Value=1.4e-16) 28 8.1 SB_27871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 88.6 bits (210), Expect = 4e-18 Identities = 45/132 (34%), Positives = 66/132 (50%) Frame = +1 Query: 250 PSWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPD 429 P + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 430 YVQQGVKTMGYKEPTPIQAQGWPIAMLERI*LA*FKRVPAKRWPTSCQPLWHINNQPPIR 609 + ++ + Y +PT IQ Q PIA+ R + K K L HI +QP ++ Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQ 586 Query: 610 RGDGPIALVLAP 645 GDGPI L+ AP Sbjct: 587 VGDGPIVLICAP 598 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.9 bits (141), Expect = 9e-10 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +1 Query: 322 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 489 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 55.2 bits (127), Expect = 5e-08 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 4/104 (3%) Frame = +1 Query: 346 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLERI*L 525 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + R + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 526 A*FKRVPAKRWPTSCQPLWHINNQPPIRRGD----GPIALVLAP 645 + K + L I P I R + GP AL+LAP Sbjct: 143 GVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAP 186 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 54.4 bits (125), Expect = 8e-08 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 1/86 (1%) Frame = +1 Query: 262 SVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQ 438 +V QPF K+FY P + K +P E +E+R + E + V G P++ + + + Sbjct: 58 TVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKIL 117 Query: 439 QGVKTMGYKEPTPIQAQGWPIAMLER 516 +K Y++PTPIQAQ P+ M R Sbjct: 118 DVLKKNSYEKPTPIQAQAIPVIMSGR 143 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 51.6 bits (118), Expect = 6e-07 Identities = 32/122 (26%), Positives = 53/122 (43%) Frame = +1 Query: 280 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 459 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 460 YKEPTPIQAQGWPIAMLERI*LA*FKRVPAKRWPTSCQPLWHINNQPPIRRGDGPIALVL 639 ++ PTPIQ Q M R + + K S + + P GD P+AL+L Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALIL 151 Query: 640 AP 645 P Sbjct: 152 TP 153 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 51.2 bits (117), Expect = 8e-07 Identities = 23/74 (31%), Positives = 39/74 (52%) Frame = +1 Query: 295 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 474 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 475 PIQAQGWPIAMLER 516 PIQ Q P+ + R Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Frame = +1 Query: 334 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 501 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = +1 Query: 361 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 EV VSG I FEEAN + V+ YK+PTP+Q PI + R Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 Score = 31.1 bits (67), Expect = 0.87 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 510 GKNLVGVVQTGSGKTLAYILPAIVA 584 G++++ QTGSGKT A++LP + + Sbjct: 748 GRDVMACAQTGSGKTAAFLLPVMTS 772 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = +1 Query: 361 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 EV VSG I FEEAN + V+ YK+PTP+Q PI + R Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/46 (41%), Positives = 31/46 (67%) Frame = +3 Query: 510 GKNLVGVVQTGSGKTLAYILPAIVAHKQPTAYSER*WSDCFGLGAL 647 G++++G +TGSGKTLA+++P I T + ++ W+ GLGAL Sbjct: 87 GRDVLGAAKTGSGKTLAFLIPII-----ETLWRQK-WTSMDGLGAL 126 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +3 Query: 447 KDNGLQRTDAYSSSRLADSYVGKNLVGVVQTGSGKTLAYILPAI 578 KD G +A G++L+G +TGSGKTLA+++P + Sbjct: 588 KDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVV 631 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 35.5 bits (78), Expect = 0.040 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +3 Query: 456 GLQRTDAYSSSRLADSYVGKNLVGVVQTGSGKTLAYILPAIVA 584 G +R + L G++L+ QTGSGKT AY+LP + + Sbjct: 498 GYRRPTPVQKAALPIVMAGRDLMACAQTGSGKTAAYMLPVLTS 540 Score = 34.7 bits (76), Expect = 0.071 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +1 Query: 370 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 VSG I F E F + + + GY+ PTP+Q PI M R Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 510 GKNLVGVVQTGSGKTLAYILPAIVAHKQPTAYSE 611 G+++ GV GSGK LAY+LP I + + Y E Sbjct: 224 GRDVAGVAIEGSGKRLAYLLPIIHQITESSVYQE 257 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +3 Query: 447 KDNGLQRTDAYSSSRLADSYVGKNLVGVVQTGSGKTLAYILPAI 578 +D G+ +S Y G++++G +TG+GKTL++ LP + Sbjct: 89 EDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLV 132 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 31.9 bits (69), Expect = 0.50 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = +3 Query: 513 KNLVGVVQTGSGKTLAYILPAIVAHKQPTAYSER 614 ++++G +TGSGKTLA+ +P I+ H + AY +R Sbjct: 169 RDIIGAAETGSGKTLAFGIP-IIQHIE--AYKKR 199 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 31.1 bits (67), Expect = 0.87 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +3 Query: 438 TRCKDNGLQRTDAYSSSRLADSYVGKNLVGVVQTGSGKTLAYILPAI 578 ++C G+++ + + G++ +G +TGSGKT A+ LP + Sbjct: 20 SQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPIL 66 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 31.1 bits (67), Expect = 0.87 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = +3 Query: 510 GKNLVGVVQTGSGKTLAYILP 572 GK++V + +TGSGKT A+++P Sbjct: 318 GKDVVAMARTGSGKTAAFLIP 338 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 382 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 495 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 397 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLER 516 I FE+ + + + V GYK+PTP+Q PI +R Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKR 913 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 513 KNLVGVVQTGSGKTLAYILPAI 578 ++L+ QTGSGKT A+++P + Sbjct: 913 RDLMACAQTGSGKTAAFLIPIL 934 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 510 GKNLVGVVQTGSGKTLAYILPAIVAHKQ 593 G + + V+ TG+GK+L Y LPA + HK+ Sbjct: 539 GMSSLVVLSTGAGKSLCYQLPAYMYHKR 566 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +3 Query: 513 KNLVGVVQTGSGKTLAYILPAIVA 584 K+++G+ +TGSGKT A+ LP + A Sbjct: 2 KDVIGLAETGSGKTGAFALPILQA 25 >SB_51385| Best HMM Match : DEAD (HMM E-Value=0.00031) Length = 127 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/35 (42%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 492 LADSYVGKNLVGVVQTGSGKTLAY-ILPAIVAHKQ 593 L Y+ K+++ V+ TG GK+L + +LPA++ HKQ Sbjct: 10 LESLYLNKDVLAVLPTGYGKSLVFHLLPALL-HKQ 43 >SB_34740| Best HMM Match : DEAD (HMM E-Value=0.00031) Length = 233 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/35 (42%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +3 Query: 492 LADSYVGKNLVGVVQTGSGKTLAY-ILPAIVAHKQ 593 L Y+ K+++ V+ TG GK+L + +LPA++ HKQ Sbjct: 116 LESLYLNKDVLAVLPTGYGKSLVFHLLPALL-HKQ 149 >SB_22560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +3 Query: 501 SYVGKNLVGVVQTGSGKTLAY-ILPAIVAHKQ 593 SY G++ +GV+ TG GK++ + ILPA+ K+ Sbjct: 192 SYTGRDGIGVLPTGYGKSVIFHILPAMYDFKR 223 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +1 Query: 292 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 432 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 516 NLVGVVQTGSGKTLAYILPAI 578 +++ QTGSGKTLAY+ P + Sbjct: 417 HVICAAQTGSGKTLAYLAPLV 437 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +1 Query: 358 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMLE 513 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ + + Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLAD 140 >SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 Query: 537 TGSGKTLAYILPAIVA 584 TGSGK+L Y LPA+VA Sbjct: 43 TGSGKSLCYQLPAVVA 58 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 483 SSRLADSYVGKNLVGVVQTGSGKTLAYILPAI 578 +S + + +GK++ TG+GKT A++LP + Sbjct: 38 ASTIPVALMGKDVCACAATGTGKTAAFMLPIL 69 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 242 CSDLQRILFSHQILQILQIYCHRC-QIETN 156 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_19645| Best HMM Match : Smr (HMM E-Value=8.2) Length = 346 Score = 27.9 bits (59), Expect = 8.1 Identities = 31/97 (31%), Positives = 40/97 (41%), Gaps = 11/97 (11%) Frame = +1 Query: 235 SEHASPSWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQ---- 402 SE AS S SLQ N N DP L R+ + R +VT ++ P Q Sbjct: 239 SEGASLMKLSTSLQSLNTNIKDPRAAFLNRTKIKDLLVRTITKVTFLQQQIAQPRQLTLT 298 Query: 403 -YFEEANFPDYV----QQG--VKTMGYKEPTPIQAQG 492 YF E + DYV Q G + G P+P + G Sbjct: 299 KYF-ETDSSDYVVELLQDGSAANSKGSDTPSPASSGG 334 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 173 CQIETNYRRICCLLQIWN-HRFHGYYSS 93 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_58343| Best HMM Match : ELM2 (HMM E-Value=1.4e-16) Length = 460 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = -2 Query: 326 DLLRTVGCGS*KFLLKGWSETESQLGD-ACSDLQRILFSHQILQILQIYCHRCQIETNYR 150 DL T+G + K LL+ + E ++GD D+ R SH+ + + + Y + I N Sbjct: 41 DLSSTLGIQAEKHLLQAEEDAEVEMGDIELEDVSRHQLSHREVFLSRQYEN---INANTI 97 Query: 149 RICCLLQIWN 120 R CL+ ++N Sbjct: 98 RGKCLVTLYN 107 >SB_27871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = -2 Query: 326 DLLRTVGCGS*KFLLKGWSETESQLGD-ACSDLQRILFSHQILQILQIYCHRCQIETNYR 150 DL T+G + K LL+ + E ++GD D+ R SH+ + + + Y + I N Sbjct: 52 DLSSTLGIQAEKHLLQAEEDAEVEMGDIELEDVSRHQLSHREVFLSRQYEN---INANTI 108 Query: 149 RICCLLQIWN 120 R CL+ ++N Sbjct: 109 RGKCLVTLYN 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,231,314 Number of Sequences: 59808 Number of extensions: 383890 Number of successful extensions: 1109 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -