BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060608.seq (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21305| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 6.1 SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_21305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 286 HLLNQMDMYHHTLDISHMSHQLLIFIH-NNHTVHQAHI 396 H L +DM HTL + HMS L +H ++HT+ H+ Sbjct: 94 HTLQVIDMSSHTLQVLHMSSHTLQVLHMSSHTLQVLHM 131 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 286 HLLNQMDMYHHTLDISHMSHQLLIFIH-NNHTVHQAHI 396 H L + M HTL + HMS L +H ++HT+ H+ Sbjct: 114 HTLQVLHMSSHTLQVLHMSSHTLQVLHMSSHTLQVLHM 151 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 286 HLLNQMDMYHHTLDISHM-SHQLLIFIHNNHTVHQAHI 396 H L + M HTL + HM SH L + ++HT+ H+ Sbjct: 134 HTLQVLHMSSHTLQVLHMSSHTLQVIDMSSHTLQVLHM 171 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 286 HLLNQMDMYHHTLDISHMSHQLLIFIH-NNHTVHQAHI 396 H L +DM HTL + MS L +H ++HT+ H+ Sbjct: 4 HTLQVIDMSSHTLQVIDMSSHTLQVLHMSSHTLQVLHM 41 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 286 HLLNQMDMYHHTLDISHMSHQLLIFIH-NNHTVHQAHI 396 H L +DM HTL + MS L +H ++HT+ H+ Sbjct: 84 HTLQVIDMSSHTLQVIDMSSHTLQVLHMSSHTLQVLHM 121 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 286 HLLNQMDMYHHTLDISHMSHQLLIFIH-NNHTVHQAHI 396 H L + M HTL + HMS L I ++HT+ H+ Sbjct: 24 HTLQVLHMSSHTLQVLHMSSNTLQVIDMSSHTLQVLHM 61 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 109 LCSHLRVPHHHMLPVRLQLSHRXPPXKRG 195 + H+R+ HH + P R + HR P K G Sbjct: 1284 MTKHIRMVHHKLWPYRCEHCHRQFPSKVG 1312 >SB_10408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 307 MYHHTLDISHMSHQLLIFIHNN--HTVHQAHIKMVVTLHRQLLRSLLXIV 450 +YH L +S +S ++I I+ N H + + + + H +LL+S ++ Sbjct: 110 LYHRHLHLSKLSKSVIIIIYQNHQHPLSSSSSFIKIRYHHRLLKSSKSVI 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,663,348 Number of Sequences: 59808 Number of extensions: 228406 Number of successful extensions: 716 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -