BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060608.seq (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 23 6.7 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 6.7 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.4 bits (48), Expect = 6.7 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 294 QSNGYVPSHTGYQPYEPPTADIYTQQSYSAPSSYQ 398 Q NGYV + G A Q S SA YQ Sbjct: 377 QQNGYVSASNGQSAQAGGPAGGQAQPSQSAAQQYQ 411 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +1 Query: 394 IKMVVTLHRQLLRSLLXIVPAVXERAMDTQQVVQEVTKRW 513 +K VV L ++ ++ + + +D +++QEV+ RW Sbjct: 290 VKRVVMLFKKSPKASQMLADTQKKLNLDQLKMIQEVSTRW 329 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,333 Number of Sequences: 2352 Number of extensions: 8567 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -