BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060603.seq (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 44 6e-06 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 44 6e-06 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 44 6e-06 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 25 2.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 6.8 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 6.8 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 23 9.0 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 43.6 bits (98), Expect = 6e-06 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +2 Query: 260 LSCGLSHTAVVPLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAP 415 +S +S TAV P++ VK LQV A ++YK +V+ F +E+G+ +G Sbjct: 19 ISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLA 78 Query: 416 TXIGYSMQGLCKFGFYEVFKVAYAGMLDDET 508 I Y F F +V+K + G +D T Sbjct: 79 NVIRYFPTQALNFAFKDVYKQVFLGGVDKNT 109 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 43.6 bits (98), Expect = 6e-06 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +2 Query: 260 LSCGLSHTAVVPLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAP 415 +S +S TAV P++ VK LQV A ++YK +V+ F +E+G+ +G Sbjct: 19 ISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLA 78 Query: 416 TXIGYSMQGLCKFGFYEVFKVAYAGMLDDET 508 I Y F F +V+K + G +D T Sbjct: 79 NVIRYFPTQALNFAFKDVYKQVFLGGVDKNT 109 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 43.6 bits (98), Expect = 6e-06 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +2 Query: 260 LSCGLSHTAVVPLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAP 415 +S +S TAV P++ VK LQV A ++YK +V+ F +E+G+ +G Sbjct: 19 ISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLA 78 Query: 416 TXIGYSMQGLCKFGFYEVFKVAYAGMLDDET 508 I Y F F +V+K + G +D T Sbjct: 79 NVIRYFPTQALNFAFKDVYKQVFLGGVDKNT 109 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 242 LRSWCVLSCGLSHTAV 289 LRSW VL+C + H V Sbjct: 577 LRSWTVLTCNVPHEVV 592 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/55 (23%), Positives = 21/55 (38%) Frame = -3 Query: 262 QNTPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDWHWAGDSGPRNGE 98 Q+ P+P + + + T A A+ P C+ T T + S P E Sbjct: 10 QSAPSPPHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDE 64 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/55 (23%), Positives = 21/55 (38%) Frame = -3 Query: 262 QNTPTPQRAKYLGDPNSQDSVGTAADAAMPPVCSIATGATVDWHWAGDSGPRNGE 98 Q+ P+P + + + T A A+ P C+ T T + S P E Sbjct: 10 QSAPSPPHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDE 64 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 165 QTGGMAASAAVPTES--CEFGSPKYFALCGVGVFCHAVSPTRPW 290 + G AA+ +P C GS + + G FC A T PW Sbjct: 458 EKGHFAATCRLPPRCVLCPDGSNAHHSS---GAFCPAAKKTAPW 498 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,064 Number of Sequences: 2352 Number of extensions: 13970 Number of successful extensions: 42 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -