BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060602.seq (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 1.7 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 1.7 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 3.9 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 421 VTYHYTRRPLYIILYN 468 VTYHY +Y I+YN Sbjct: 198 VTYHYFEEEIYQIIYN 213 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 421 VTYHYTRRPLYIILYN 468 VTYHY +Y I+YN Sbjct: 198 VTYHYFEEEIYQIIYN 213 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 24.2 bits (50), Expect = 3.9 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 11/85 (12%) Frame = +2 Query: 371 IFPWRDSNPRAPCVVIMSLTTTPDGRYILY--YIIYSLFTF-ISAKNSNN-----QN*LT 526 +FP +NPR + + T PD I Y ++ L + I +N N +N LT Sbjct: 272 VFPSDKNNPRLALIFLGYTTPPPDSDGIKYSDSLLGQLLSLSIMPRNHNGPYEYYENPLT 331 Query: 527 IQQTVITLVLINNW---LLHLSRPH 592 ++ + + N W HL+R H Sbjct: 332 TNRSAVDSLSSNLWNYTKRHLARMH 356 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,123 Number of Sequences: 2352 Number of extensions: 10089 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -