BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060601.seq (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.89 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 4.7 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 22 4.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 6.3 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.3 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.3 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.6 bits (51), Expect = 0.89 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 414 TNINVQVSSHALSALAPGALITPTPFLPAESTSMLS 307 TN+ +++ S ++ P LPA STS+ S Sbjct: 833 TNVTTTINTPTTSVISMSGTTVPITSLPASSTSINS 868 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -2 Query: 305 HQLQHDRPPSASRLRPTLFGHLS 237 H HD PP S LF H S Sbjct: 133 HLAMHDYPPLVSGALHLLFRHFS 155 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -2 Query: 305 HQLQHDRPPSASRLRPTLFGHLS 237 H HD PP S LF H S Sbjct: 101 HLAMHDYPPLVSGALHLLFRHFS 123 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -1 Query: 297 PARPTTF-SFT-PASNTLWSLELLN 229 P+R +T SF P SNTLW L +++ Sbjct: 551 PSRSSTLVSFLQPFSNTLWILVMVS 575 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 411 WFWLATWSQLPL 446 WFW+ ++ LPL Sbjct: 179 WFWVTPFTVLPL 190 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 Query: 411 WFWLATWSQLPL 446 WFW+ ++ LPL Sbjct: 179 WFWVTPFTVLPL 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,783 Number of Sequences: 438 Number of extensions: 3729 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -