BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060599.seq (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 24 3.9 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 6.7 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 6.7 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +3 Query: 6 QKKTLMAGLEKDPLVYERSGTVREVGNHAIWSLSSCKPGFGIDQLRDDCMETYWQSDGQ 182 Q L A E+ V S +R N+ W+ SSCK + + + ++ W S+ Q Sbjct: 29 QNLVLQAAREEKADVLILSDVLRPPENNGRWAFSSCK-AVAVVAVGELPIQRVWCSEAQ 86 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.4 bits (48), Expect = 6.7 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 293 LLIFCLVYSFHLIIV 249 +L+ CL+Y+F LI++ Sbjct: 214 VLVMCLMYTFPLIVI 228 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.4 bits (48), Expect = 6.7 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -3 Query: 293 LLIFCLVYSFHLIIV 249 +L+ CL+Y+F LI++ Sbjct: 214 VLVMCLMYTFPLIVI 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,836 Number of Sequences: 2352 Number of extensions: 14895 Number of successful extensions: 37 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -