BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060594.seq (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38920.1 68417.m05515 vacuolar ATP synthase 16 kDa proteolipi... 107 5e-24 At4g34720.1 68417.m04928 vacuolar ATP synthase 16 kDa proteolipi... 107 5e-24 At2g16510.1 68415.m01893 vacuolar ATP synthase 16 kDa proteolipi... 107 5e-24 At1g75630.1 68414.m08787 vacuolar ATP synthase 16 kDa proteolipi... 107 5e-24 At1g19910.1 68414.m02496 vacuolar ATP synthase 16 kDa proteolipi... 107 5e-24 At4g32530.1 68417.m04631 vacuolar ATP synthase, putative / V-ATP... 56 3e-08 At2g25610.1 68415.m03068 H+-transporting two-sector ATPase, C su... 56 3e-08 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 31 0.54 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 31 0.94 At5g65910.1 68418.m08296 BSD domain-containing protein contains ... 30 1.2 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 30 1.6 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 30 1.6 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 29 2.2 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 29 2.2 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 29 2.9 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 3.8 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 3.8 At1g21160.1 68414.m02646 eukaryotic translation initiation facto... 29 3.8 At1g11840.2 68414.m01362 lactoylglutathione lyase, putative / gl... 29 3.8 At1g11840.1 68414.m01361 lactoylglutathione lyase, putative / gl... 29 3.8 At3g15700.1 68416.m01990 disease resistance protein, putative si... 28 5.0 At2g31040.1 68415.m03786 ATP synthase protein I -related contain... 28 5.0 At1g54490.1 68414.m06215 5'-3' exoribonuclease (XRN4) identical ... 28 5.0 At5g65690.1 68418.m08266 phosphoenolpyruvate carboxykinase [ATP]... 28 6.6 At4g36550.1 68417.m05190 U-box domain-containing protein low sim... 28 6.6 At5g67340.1 68418.m08492 armadillo/beta-catenin repeat family pr... 27 8.8 At5g42720.1 68418.m05203 glycosyl hydrolase family 17 protein si... 27 8.8 At4g37870.1 68417.m05356 phosphoenolpyruvate carboxykinase [ATP]... 27 8.8 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 27 8.8 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 27 8.8 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 27 8.8 >At4g38920.1 68417.m05515 vacuolar ATP synthase 16 kDa proteolipid subunit 3 / V-ATPase 16 kDa proteolipid subunit 3 (AVAP3) (AVA-P3) identical to SP|P59227 Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 (EC 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 1/3/5) {Arabidopsis thaliana}; contains Pfam profile PF00137: ATP synthase subunit C Length = 164 Score = 107 bits (258), Expect = 5e-24 Identities = 52/87 (59%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +1 Query: 10 GIIAIYGLVVAVLIAGALQEPA-NYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVR 186 G++ IYGL++AV+I+ + A +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR Sbjct: 62 GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR 121 Query: 187 GTAQQPRLFVGMILILIFAEVLGFTDL 267 AQQP+LFVGMILILIFAE L L Sbjct: 122 ANAQQPKLFVGMILILIFAEALALYGL 148 >At4g34720.1 68417.m04928 vacuolar ATP synthase 16 kDa proteolipid subunit 1 / V-ATPase 16 kDa proteolipid subunit 1 (AVAP1) (AVA-P1) identical to SP|P59227 Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 (EC 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 1/3/5) {Arabidopsis thaliana}; contains Pfam profile PF00137: ATP synthase subunit C Length = 164 Score = 107 bits (258), Expect = 5e-24 Identities = 52/87 (59%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +1 Query: 10 GIIAIYGLVVAVLIAGALQEPA-NYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVR 186 G++ IYGL++AV+I+ + A +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR Sbjct: 62 GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR 121 Query: 187 GTAQQPRLFVGMILILIFAEVLGFTDL 267 AQQP+LFVGMILILIFAE L L Sbjct: 122 ANAQQPKLFVGMILILIFAEALALYGL 148 >At2g16510.1 68415.m01893 vacuolar ATP synthase 16 kDa proteolipid subunit 5 / V-ATPase 16 kDa proteolipid subunit 5 (AVAP5) identical to SP|P59227 Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 (EC 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 1/3/5) {Arabidopsis thaliana} GI:926929; contains Pfam profile PF00137: ATP synthase subunit C Length = 164 Score = 107 bits (258), Expect = 5e-24 Identities = 52/87 (59%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +1 Query: 10 GIIAIYGLVVAVLIAGALQEPA-NYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVR 186 G++ IYGL++AV+I+ + A +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR Sbjct: 62 GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR 121 Query: 187 GTAQQPRLFVGMILILIFAEVLGFTDL 267 AQQP+LFVGMILILIFAE L L Sbjct: 122 ANAQQPKLFVGMILILIFAEALALYGL 148 >At1g75630.1 68414.m08787 vacuolar ATP synthase 16 kDa proteolipid subunit 4 / V-ATPase 16 kDa proteolipid subunit 4 (AVAP4) (AVA-P4) identical to SP|P59229 Vacuolar ATP synthase 16 kDa proteolipid subunit 4 (EC 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 4) {Arabidopsis thaliana}; contains Pfam profile PF00137: ATP synthase subunit C Length = 166 Score = 107 bits (258), Expect = 5e-24 Identities = 52/87 (59%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +1 Query: 10 GIIAIYGLVVAVLIAGALQEPA-NYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVR 186 G++ IYGL++AV+I+ + A +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR Sbjct: 64 GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR 123 Query: 187 GTAQQPRLFVGMILILIFAEVLGFTDL 267 AQQP+LFVGMILILIFAE L L Sbjct: 124 ANAQQPKLFVGMILILIFAEALALYGL 150 >At1g19910.1 68414.m02496 vacuolar ATP synthase 16 kDa proteolipid subunit 2 / V-ATPase 16 kDa proteolipid subunit 2 (AVAP2) (AVA-P2) identical to SP|Q39039 Vacuolar ATP synthase 16 kDa proteolipid subunit 2 (EC 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 2 {Arabidopsis thaliana}, nearly identical to vacuolar H+-ATPase proteolipid (16 kDa) subunit GI:755147 from [Gossypium hirsutum] Length = 165 Score = 107 bits (258), Expect = 5e-24 Identities = 52/87 (59%), Positives = 66/87 (75%), Gaps = 1/87 (1%) Frame = +1 Query: 10 GIIAIYGLVVAVLIAGALQEPA-NYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVR 186 G++ IYGL++AV+I+ + A +Y L+ G+ HL +GLA G +GL+AG AIGIVGDAGVR Sbjct: 63 GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVR 122 Query: 187 GTAQQPRLFVGMILILIFAEVLGFTDL 267 AQQP+LFVGMILILIFAE L L Sbjct: 123 ANAQQPKLFVGMILILIFAEALALYGL 149 >At4g32530.1 68417.m04631 vacuolar ATP synthase, putative / V-ATPase, putative SP|P23968 Vacuolar ATP synthase 22 kDa proteolipid subunit (EC 3.6.3.14) {Saccharomyces cerevisiae}; contains Pfam profile PF00137: ATP synthase subunit C Length = 180 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +1 Query: 16 IAIYGLVVAVLIAGALQEPANYPLYK------GFIHLGAGLAVGFSGLAAGFAIGIVGDA 177 +AIYG++VA+++ L+ + +Y G+ +G+ VGF+ L G +GI+G + Sbjct: 76 VAIYGVIVAIILQTKLESVPSSKMYDAESLRAGYAIFASGIIVGFANLVCGLCVGIIGSS 135 Query: 178 GVRGTAQQPRLFVGMILILIFAEVLG 255 AQ LFV +++I IF LG Sbjct: 136 CALSDAQNSTLFVKILVIEIFGSALG 161 >At2g25610.1 68415.m03068 H+-transporting two-sector ATPase, C subunit family protein similar to SP|P23968 Vacuolar ATP synthase 22 kDa proteolipid subunit (EC 3.6.3.14) {Saccharomyces cerevisiae}; contains Pfam profile PF00137: ATP synthase subunit C Length = 178 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = +1 Query: 16 IAIYGLVVAVLIAGALQEPANYPLYK------GFIHLGAGLAVGFSGLAAGFAIGIVGDA 177 +AIYG++VA+++ L+ + +Y G+ +G+ VGF+ L G +GI+G + Sbjct: 74 VAIYGVIVAIILQTKLESVPSSKMYDAESLRAGYAIFASGIIVGFANLVCGLCVGIIGSS 133 Query: 178 GVRGTAQQPRLFVGMILILIFAEVLG 255 AQ LFV +++I IF LG Sbjct: 134 CALSDAQNSTLFVKILVIEIFGSALG 159 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+ +PT P KPA P P KPAP Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+ +PT P KP P P KPAP Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+ +PT P KPA P P KP P Sbjct: 64 PKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+ +PT P KP P P KPAP Sbjct: 86 PKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P +P P KPA P NP PAP Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+ +PT P KP P P KP P Sbjct: 75 PKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+ +PT P KP P P KP P Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKP 57 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAPK 105 P+ +PT P KPA P PT P PK Sbjct: 97 PKPTPAPTPPKPKPAPAPA-PTPAPKPK 123 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -1 Query: 182 TPA-SPTMPMAKPAARPENPTAKPAP 108 TPA +P P KPA P P PAP Sbjct: 45 TPAPTPPKPKPKPAPTPPKPKPAPAP 70 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.7 bits (66), Expect = 0.94 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = -1 Query: 275 GDDKSVKPNTSAKIRIRIIPTNNLGC*AVPRTP-----ASPTMPMAKPAARPENPTAKPA 111 G SV P + + + P + +P TP A P MPMA P P P+ P+ Sbjct: 44 GGGSSVPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPS 103 Query: 110 P 108 P Sbjct: 104 P 104 >At5g65910.1 68418.m08296 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 432 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -1 Query: 416 NPMQGGPATGDDHPCARLQTQIMS---IEARSTGDGSGVCSGRLFCVQVDGDD 267 NP++ D HP + QI+ IE RST S S R VQVD +D Sbjct: 289 NPVESSDVETDKHPIESKEIQIVDKSVIEERSTSTAS---SSRFINVQVDDED 338 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 226 LILIFAEVLGFTDLSSPSTCTQNKRPEHTPLPSP 327 + L FA + F L++ + C N P+H P+PSP Sbjct: 9 IALFFALNIIFFTLTAATDCGCNPSPKHKPVPSP 42 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAPKWMNP 93 P TP PT P P + P+ PT KP P P Sbjct: 125 PSTPKPPTKP---PPSTPKPPTTKPPPSTPKP 153 >At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 299 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+TPAS + P+A RP P P P Sbjct: 108 PQTPASVSAPVAPAPTRPPPPAPTPTP 134 >At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 419 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAP 108 P+TPAS + P+A RP P P P Sbjct: 108 PQTPASVSAPVAPAPTRPPPPAPTPTP 134 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -1 Query: 191 VPRTPAS-----PTMPMAKPAARPENPTAKPAPKWMNPL 90 VP TP PT P+ KP+ P P KP+P P+ Sbjct: 431 VPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPSPVPTTPV 469 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -1 Query: 191 VPRTPAS-----PTMPMAKPAARPENPTAKPAPKWMNPL 90 VP TP PT P+ KP+ P P +P+P P+ Sbjct: 442 VPTTPVQKPSPVPTTPVQKPSPVPTTPVHEPSPVLATPV 480 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 194 AVPRTPASPTMPMAKPAARPENPTAKPAP 108 A P TP + P P PE+P + PAP Sbjct: 132 APPTTPITSPSPPTNPPPPPESPPSLPAP 160 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -1 Query: 461 EQGTNVIYKSGRVLRNPMQGGPATGDDHPCARLQTQIMSIEARSTGDGSGV 309 + + + K +LR P G P P + +Q ++E +STG + V Sbjct: 1455 QSNNSYVRKGNSLLRKPSHGSPGAALGIPPSAIQLNHFTVEDKSTGSSNMV 1505 >At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1088 Score = 28.7 bits (61), Expect = 3.8 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 10/93 (10%) Frame = -1 Query: 338 ARSTGDGSGVCSGRL-FCVQVDGDDKSVKP---------NTSAKIRIRIIPTNNLGC*AV 189 ++ GD V + F ++ D DD+ KP +T++K PT G Sbjct: 391 SQENGDEEDVWDAKTNFTIKGDSDDEEEKPQPVFKKGLKDTASKAHDSDRPTVKPGGSGK 450 Query: 188 PRTPASPTMPMAKPAARPENPTAKPAPKWMNPL 90 P+T A MP RP++ + K +N L Sbjct: 451 PKTAAKKAMPKVDDTTRPKDTSKKDEGLVLNEL 483 >At1g11840.2 68414.m01362 lactoylglutathione lyase, putative / glyoxalase I, putative highly similar to putative lactoylglutathione lyase SP:Q39366 from [Brassica oleracea] Length = 283 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -1 Query: 455 GTNVIYKSGRVLR--NPMQGGPATGDDHPCARLQTQIMS 345 GT+ +YKSG V++ N GG T + P L T+I+S Sbjct: 223 GTDDVYKSGEVIKIVNQELGGKITREAGPLPGLGTKIVS 261 >At1g11840.1 68414.m01361 lactoylglutathione lyase, putative / glyoxalase I, putative highly similar to putative lactoylglutathione lyase SP:Q39366 from [Brassica oleracea] Length = 283 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -1 Query: 455 GTNVIYKSGRVLR--NPMQGGPATGDDHPCARLQTQIMS 345 GT+ +YKSG V++ N GG T + P L T+I+S Sbjct: 223 GTDDVYKSGEVIKIVNQELGGKITREAGPLPGLGTKIVS 261 >At3g15700.1 68416.m01990 disease resistance protein, putative similar to NBS/LRR disease resistance protein [Arabidopsis thaliana] gi|3309619|gb|AAC26125; contains Pfam profile: PF00931 NB-ARC domain Length = 375 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Frame = -1 Query: 386 DDHPCARLQTQIMSIEARSTGD----GSGVCSGRLFCVQVDGDDKSVKPNTSAKIRIRII 219 D C +L+ ++ I++R T D SG+ SG + VD DD++V + + R + Sbjct: 97 DKKLCKKLK-EVQEIKSRGTFDVVVENSGIGSGSMMISNVDRDDQTVGLEAVSGLVWRCM 155 Query: 218 PTNNLG 201 +N G Sbjct: 156 TVDNTG 161 >At2g31040.1 68415.m03786 ATP synthase protein I -related contains weaks similarity to Swiss-Prot:P08443 ATP synthase protein I [Synechococcus sp.] Length = 350 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 169 GDAGV-RGTAQQPRLFVGMILILIF 240 G GV +G A QPRL V ++L++IF Sbjct: 267 GARGVAKGAANQPRLLVPVVLVMIF 291 >At1g54490.1 68414.m06215 5'-3' exoribonuclease (XRN4) identical to XRN4 [Arabidopsis thaliana] GI:11875626; contains Pfam domain PF03159: Putative 5'-3' exonuclease domain Length = 947 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 385 SPVAGPPCIGFRSTLPLLYITFVPCSFSHISRP 483 SPV G PCI L + Y+ P SHIS P Sbjct: 671 SPVNGLPCIEQNRALNVTYL--CPAKHSHISEP 701 >At5g65690.1 68418.m08266 phosphoenolpyruvate carboxykinase [ATP], putative / PEP carboxykinase, putative / PEPCK, putative similar to phosphoenolpyruvate carboxykinase [Lycopersicon esculentum] GI:16950587, SP|Q9SLZ0 Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49) (PEP carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) {Zea mays}; contains Pfam profile PF01293: phosphoenolpyruvate carboxykinase Length = 670 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 284 QVDGDDKSVKPNTSAKIRIRIIPTNNLGC 198 +VD DKSV NT A I IP + + C Sbjct: 441 EVDYTDKSVTENTRAAYPIEYIPNSKIPC 469 >At4g36550.1 68417.m05190 U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 577 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 185 RTPASPTMPMAKPAARPENPTAKPAPK 105 RT ASPT + P PE P+PK Sbjct: 534 RTTASPTSQVVTPVTHPEPVKITPSPK 560 >At5g67340.1 68418.m08492 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 707 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = +3 Query: 252 GLYGLIVAIYLYXXXXXXXXXXXVARAPSLYAHYLSLKTRTGMVVAGSGSTLHRV 416 GL L ++ Y R PS + LSL+ T V+ SG T RV Sbjct: 214 GLISLTTQMHEYLSDIKQAQLRCPVRVPSDFRCSLSLELMTDPVIVASGQTFERV 268 >At5g42720.1 68418.m05203 glycosyl hydrolase family 17 protein similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 438 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = -1 Query: 257 KPNTSAKIRIRIIPTNNLGC*AVPRTPASPTMPMAKPAARPENPTAKPAPKWMNP 93 +P+ + I + T N P SPT P PAA P T P+ + P Sbjct: 335 RPDLTMTYDIGLTKTTNYN--QTSMAPLSPTRPRLPPAAAPTRQTLPSPPQMILP 387 >At4g37870.1 68417.m05356 phosphoenolpyruvate carboxykinase [ATP], putative / PEP carboxykinase, putative / PEPCK, putative similar to phosphoenolpyruvate carboxykinase [Lycopersicon esculentum] GI:16950587, SP|Q9SLZ0 Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49) (PEP carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) {Zea mays}; contains Pfam profile PF01293: phosphoenolpyruvate carboxykinase Length = 671 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 284 QVDGDDKSVKPNTSAKIRIRIIPTNNLGC 198 +VD DKSV NT A I IP + C Sbjct: 442 EVDYSDKSVTENTRAAYPIEFIPNAKIPC 470 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -1 Query: 188 PRTPASPTMP--MAKPAARPENPTAKPAPKWM 99 P+ PA P P + P P+ PT KP P ++ Sbjct: 42 PKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYI 73 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 223 ILILIFAEVLGFTDLSSPSTCTQNKRPEHTP-LPSPV 330 I +++ + D SPS+ K PEH P LPSPV Sbjct: 10 ICLILSLVTITTADYYSPSSPPVYKSPEHKPTLPSPV 46 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 220 MILILIFAEVLGFTDLSSPSTCTQNK-RPEHTPLPSPV 330 ++ +L+ LG + + T N +P+H+PLPSPV Sbjct: 10 LVFLLVTLITLGEANNNRKLLYTYNNYQPQHSPLPSPV 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,283,981 Number of Sequences: 28952 Number of extensions: 366579 Number of successful extensions: 1212 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1207 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -