BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060593.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 24 5.1 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 9.0 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 145 GSAIAKIVGRNAASLSNFEDRVT 213 GSA++ + AS+ +F DR+T Sbjct: 260 GSAVSNLAQLTTASMQSFADRMT 282 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/61 (22%), Positives = 26/61 (42%) Frame = -3 Query: 305 FVARQVFNIFMSFXDYFVNFFPSIISSYTHIVTLSSKFDRLAAFRPTIFAIAEPQFPDPT 126 F+ + F MS Y + ++ Y+ V + + D P+I ++ QF DP Sbjct: 99 FLQQPDFATLMSVATYCRDRLNPVLFQYSLAVAVQHREDTKDVNIPSIVSLFPDQFVDPA 158 Query: 125 M 123 + Sbjct: 159 V 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 653,564 Number of Sequences: 2352 Number of extensions: 12472 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -