BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060593.seq (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 136 1e-34 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 26 0.29 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.6 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 3.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 3.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 3.6 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 6.3 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 136 bits (330), Expect = 1e-34 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 1/92 (1%) Frame = +3 Query: 243 KEVNEIIXETHENVKYLPGHKLPSNVVAVPDVVEAAKDADLLIFVVPHQFVRTICSTLLG 422 K++ EII ETHENVKYLPGHKLP N++A+PDVVEAAKDAD+L FVVPHQF++ ICS L G Sbjct: 49 KKLTEIINETHENVKYLPGHKLPPNIIAIPDVVEAAKDADILTFVVPHQFIKRICSALFG 108 Query: 423 KIKPTAAALSLIKGFDIAEGWA-SILYHIFYK 515 KIKPTA LSLIKGFD +G ++ HI K Sbjct: 109 KIKPTAIGLSLIKGFDKKQGGGIELISHIISK 140 Score = 79.8 bits (188), Expect = 2e-17 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 109 KNKVCIVGSGNWGSAIAKIVGRNAASLSNFEDRVTMWVYEEIIEG 243 K ++CIVGSGNWGS IAKI+G NAA+ SNFEDRVTM+VYEEII G Sbjct: 4 KLRICIVGSGNWGSTIAKIIGINAANFSNFEDRVTMYVYEEIING 48 Score = 70.5 bits (165), Expect = 1e-14 Identities = 29/46 (63%), Positives = 39/46 (84%) Frame = +1 Query: 520 LKIPCAVLMGANIASEVAEEKFCETTIGCRDVMLAPLMRDIIQTDY 657 L IP +VLMGAN+ASEVA E FCETTIGC+D +AP+++D+++T Y Sbjct: 142 LHIPVSVLMGANLASEVANEMFCETTIGCKDKNMAPILKDLMETSY 187 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 26.2 bits (55), Expect = 0.29 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 245 FPSIISSYTHIVTLSSKFDRLAAFRPTIFAIAEPQFP 135 F S+ ++ T S F ++ A PT+F+ P+FP Sbjct: 332 FWSLRKAFARKKTDYSSFGKILATEPTLFSNVTPKFP 368 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 597 HWXSGRNAGSVNAGY 641 HW SG N G+ GY Sbjct: 1423 HWKSGHNGGASLTGY 1437 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 597 HWXSGRNAGSVNAGY 641 HW SG N G+ GY Sbjct: 1419 HWKSGHNGGASLTGY 1433 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 248 FFPSIISSYTHIVTLSSKFDRL 183 FF + SY HI T S++F R+ Sbjct: 99 FFVNEKQSYFHIATTSNEFIRI 120 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 248 FFPSIISSYTHIVTLSSKFDRL 183 FF + SY HI T S++F R+ Sbjct: 99 FFVNEKQSYFHIATTSNEFIRI 120 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 248 FFPSIISSYTHIVTLSSKFDRL 183 FF + SY HI T S++F R+ Sbjct: 38 FFVNEKQSYFHIATTSNEFIRI 59 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -1 Query: 601 QWSFRRIFPQQPPMQYWLPLI 539 QW+ R+ P +++W+PL+ Sbjct: 486 QWTCRQPEPLIELIEHWMPLL 506 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,316 Number of Sequences: 438 Number of extensions: 3623 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -