BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060586.seq (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 25 0.67 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 25 0.67 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.7 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.7 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.7 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 4.7 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 4.7 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.2 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.2 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.2 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.2 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.2 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.2 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.2 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.2 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 25.0 bits (52), Expect = 0.67 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 177 FLRRAEHCMGKVAEAPESPVSKCVSSMSPIVV 82 +LRR C + EAP PV + + S++P+V+ Sbjct: 47 YLRRQLKCA--LGEAPCDPVGRRLKSLAPLVL 76 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 25.0 bits (52), Expect = 0.67 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 177 FLRRAEHCMGKVAEAPESPVSKCVSSMSPIVV 82 +LRR C + EAP PV + + S++P+V+ Sbjct: 47 YLRRQLKCA--LGEAPCDPVGRRLKSLAPLVL 76 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 96 TSKTHTSRPETPGPQ 140 T H PETPGPQ Sbjct: 462 TPHHHPHPPETPGPQ 476 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 277 DIFNGKKYEDIC 312 D+ N +KYED+C Sbjct: 597 DLSNERKYEDVC 608 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 243 FPVLDVDISTILHGR 199 FPVL V I+ +LHG+ Sbjct: 8 FPVLFVIINVLLHGQ 22 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -3 Query: 610 NXKVCYPYKMLSWFICPRAVFALTAMTHSSPQDFARCTTIPCRCRSQYAT 461 N K + Y + +C A+F A P+ F RC S++ T Sbjct: 4 NTKQAFIYSLA--LLCLHAIFVNAAPDWVPPEVFDLVAEDKARCMSEHGT 51 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -3 Query: 610 NXKVCYPYKMLSWFICPRAVFALTAMTHSSPQDFARCTTIPCRCRSQYAT 461 N K + Y + +C A+F A P+ F RC S++ T Sbjct: 4 NTKQAFIYSLA--LLCLHAIFVNAAPDWVPPEVFDLVAEDKARCMSEHGT 51 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 412 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 494 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 396 N L + +R N PSG +RS+ +P+S R Sbjct: 412 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,960 Number of Sequences: 438 Number of extensions: 4893 Number of successful extensions: 19 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -